F185318

General Info

Members Datasets Scaffolds Average Seq Length
142 88 142 124

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10000434|Ga0075368_100004343
Length 135
Sequence MIDAIHRFHGRGSLRFVYQHGKTVRCPHAALKYSPNQRRRTYRVAVVVSRKVHKSAVVRNRIRRRLYELVRAHDAAITQPYDLVFTAFSDQLATMPAPELEALLAKLLSSAGIIPAPSPAHTSQDHDIVDAKEHA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
32 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
70 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
71 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
72 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
73 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
74 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
75 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
76 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
77 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
78 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
79 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
80 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
81 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
82 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
83 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
84 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
85 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
86 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
87 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
88 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 43.66
Nodule 0
Rhizoplane 0.7
Rhizosphere 52.82
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001270 3300001915 Bacteria 7413
2 JGI24740J21852_10041047 3300001979 Bacteria 1397
3 JGI24737J22298_10000008 3300001990 Bacteria 59168
4 JGI24735J21928_10000025 3300002067 Bacteria 88931
5 JGI24742J22300_10000009 3300002244 Bacteria 33403
6 rootH2_10080305 3300003320 Bacteria 8745
7 rootH1_10119277 3300003323 Bacteria 1688
8 rootH1_10196335 3300003323 Unclassified 4530
9 Ga0070676_10001177 3300005328 Bacteria 13106
10 Ga0070683_100001133 3300005329 Bacteria 20171
11 Ga0070683_101211922 3300005329 Bacteria 725
12 Ga0070690_101031659 3300005330 Unclassified 649
13 Ga0068869_100443081 3300005334 Bacteria 1075
14 Ga0070671_100559838 3300005355 Unclassified 986
15 Ga0070679_100371052 3300005530 Bacteria 1378
16 Ga0070684_100000560 3300005535 Bacteria 25573
17 Ga0068853_100020324 3300005539 Bacteria 5521
18 Ga0068855_100000001 3300005563 Bacteria 818777
19 Ga0068857_100005654 3300005577 Bacteria 10691
20 Ga0068857_100049842 3300005577 Bacteria 3715
21 Ga0068857_100270582 3300005577 Bacteria 1561
22 Ga0068857_101598711 3300005577 Unclassified 636
23 Ga0068856_100000634 3300005614 Bacteria 38219
24 Ga0068856_100004979 3300005614 Bacteria 13150
25 Ga0068856_100435754 3300005614 Unclassified 1331
26 Ga0075365_10001202 3300006038 Bacteria 11423
27 Ga0075368_10000434 3300006042 Bacteria 12351
28 Ga0075368_10007501 3300006042 Bacteria 3848
29 Ga0075363_100000159 3300006048 Bacteria 17097
30 Ga0075364_10000008 3300006051 Bacteria 69045
31 Ga0075364_10000051 3300006051 Bacteria 42399
32 Ga0075364_10013517 3300006051 Bacteria 5021
33 Ga0075364_10083124 3300006051 Bacteria 2119
34 Ga0075364_10154768 3300006051 Bacteria 1546
35 Ga0075364_10217125 3300006051 Bacteria 1297
36 Ga0075364_10740896 3300006051 Unclassified 670
37 Ga0075362_10037855 3300006177 Bacteria 2117
38 Ga0075362_10431851 3300006177 Unclassified 667
39 Ga0075367_10000038 3300006178 Bacteria 29318
40 Ga0075367_10004582 3300006178 Bacteria 6763
41 Ga0075367_10145800 3300006178 Bacteria 1468
42 Ga0075369_10000102 3300006186 Bacteria 22819
43 Ga0075369_10346094 3300006186 Unclassified 697
44 Ga0075366_10000002 3300006195 Bacteria 153795
45 Ga0075366_10000004 3300006195 Bacteria 111331
46 Ga0075366_10000382 3300006195 Bacteria 20515
47 Ga0075370_10008124 3300006353 Bacteria 5389
48 Ga0075370_10438633 3300006353 Unclassified 785
49 Ga0105245_12744918 3300009098 Unclassified 545
50 Ga0105241_10000009 3300009174 Bacteria 258876
51 Ga0105248_10716472 3300009177 Unclassified 1129
52 Ga0105032_110979 3300009979 Bacteria 730
53 Ga0105028_100603 3300009993 Unclassified 3798
54 Ga0105239_10202327 3300010375 Unclassified 2225
55 Ga0157370_10167571 3300013104 Bacteria 2042
56 Ga0157369_10001636 3300013105 Bacteria 27361
57 Ga0157374_10333043 3300013296 Bacteria 1506
58 Ga0157375_10645328 3300013308 Bacteria 1215
59 Ga0163163_10006019 3300014325 Bacteria 10553
60 Ga0207645_10006038 3300025907 Bacteria 8707
61 Ga0207654_10000002 3300025911 Bacteria 1460142
62 Ga0207695_10020175 3300025913 Bacteria 7641
63 Ga0207662_10368902 3300025918 Unclassified 968
64 Ga0207652_10315011 3300025921 Bacteria 1412
65 Ga0207687_11588360 3300025927 Unclassified 561
66 Ga0207709_10016772 3300025935 Bacteria 4078
67 Ga0207661_10000412 3300025944 Bacteria 27614
68 Ga0207661_10975706 3300025944 Bacteria 780
69 Ga0207667_10000003 3300025949 Bacteria 822935
70 Ga0207639_10116108 3300026041 Unclassified 2191
71 Ga0207702_10877721 3300026078 Unclassified 888
72 Ga0207674_10011548 3300026116 Bacteria 9920
73 Ga0207674_10112405 3300026116 Bacteria 2697
74 Ga0209813_10000003 3300027866 Bacteria 207060
75 Ga0209813_10002828 3300027866 Bacteria 4016
76 Ga0265334_10000502 3300028573 Bacteria 20124
77 Ga0265334_10010801 3300028573 Bacteria 3854
78 Ga0265334_10015986 3300028573 Bacteria 3109
79 Ga0265322_10002362 3300028654 Bacteria 5839
80 Ga0265336_10000020 3300028666 Bacteria 213480
81 Ga0265338_10000074 3300028800 Bacteria 181183
82 Ga0265338_10000217 3300028800 Bacteria 106453
83 Ga0265338_10000894 3300028800 Bacteria 50064
84 Ga0265338_10486898 3300028800 Bacteria 870
85 Ga0265324_10006011 3300029957 Bacteria 5137
86 Ga0265324_10021306 3300029957 Bacteria 2325
87 Ga0265320_10109820 3300031240 Unclassified 1264
88 Ga0265325_10064875 3300031241 Unclassified 1845
89 Ga0265325_10283283 3300031241 Unclassified 743
90 Ga0265340_10000983 3300031247 Bacteria 16295
91 Ga0265327_10181413 3300031251 Bacteria 962
92 Ga0265316_10004980 3300031344 Bacteria 13044
93 Ga0265316_10512076 3300031344 Unclassified 857
94 Ga0265316_11270512 3300031344 Unclassified 509
95 Ga0265313_10065471 3300031595 Unclassified 1687
96 Ga0265314_10032104 3300031711 Unclassified 3867
97 Ga0265314_10058988 3300031711 Bacteria 2628
98 Ga0395900_0353552 3300037418 Bacteria 1442
99 Ga0395900_0699764 3300037418 Unclassified 947
100 Ga0451807_2645929 3300041486 Unclassified 574
101 Ga0451839_0751299 3300041496 Bacteria 1086
102 Ga0495622_0000008 3300046557 Bacteria 232461
103 Ga0495658_0006102 3300046683 Bacteria 5917
104 Ga0495671_0137969 3300046692 Unclassified 1189
105 Ga0495600_0009146 3300046809 Bacteria 6111
106 nmdc:mga03683_18038_c1 3300050489 Bacteria 2678
107 nmdc:mga03683_48010_c1 3300050489 Bacteria 1773
108 nmdc:mga03n38_58_c1 3300050490 Bacteria 23178
109 nmdc:mga00v17_138_c1 3300050491 Bacteria 42417
110 nmdc:mga00v17_15339_c2 3300050491 Bacteria 2354
111 nmdc:mga00v17_8285_c1 3300050491 Bacteria 5590
112 nmdc:mga00v17_86756_c1 3300050491 Unclassified 1342
113 nmdc:mga0yw44_538642_c1 3300050492 Bacteria 793
114 nmdc:mga0yw44_97_c1 3300050492 Bacteria 30914
115 nmdc:mga0k408_11_c1 3300050493 Bacteria 130371
116 nmdc:mga0k408_15_c1 3300050493 Bacteria 124193
117 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
118 nmdc:mga0k408_264_c1 3300050493 Bacteria 28733
119 nmdc:mga0k408_271310_c1 3300050493 Unclassified 602
120 nmdc:mga0k408_362_c1 3300050493 Bacteria 24934
121 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
122 nmdc:mga06z11_349272_c1 3300050494 Bacteria 885
123 nmdc:mga06z11_55_c1 3300050494 Bacteria 48353
124 nmdc:mga04h51_3325_c1 3300050495 Bacteria 3900
125 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
126 nmdc:mga07m45_389712_c1 3300050496 Unclassified 809
127 nmdc:mga07m45_939_c1 3300050496 Bacteria 12756
128 nmdc:mga0sz30_12_c1 3300050516 Bacteria 96867
129 nmdc:mga0sz30_315729_c1 3300050516 Unclassified 697
130 nmdc:mga0sz30_334157_c1 3300050516 Unclassified 677
131 Ga0500651_0000011 3300053093 Bacteria 246573
132 Ga0500651_0017835 3300053093 Bacteria 4387
133 Ga0500566_0000001 3300053094 Bacteria 1101031
134 Ga0500556_0000506 3300053104 Bacteria 26798
135 Ga0500594_0142915 3300053118 Bacteria 765
136 Ga0500614_000001 3300053123 Bacteria 1274484
137 Ga0500614_000224 3300053123 Bacteria 14867
138 Ga0500614_004187 3300053123 Bacteria 3062
139 Ga0500574_110141 3300053141 Bacteria 816
140 Ga0500604_0078989 3300053151 Bacteria 1060
141 Ga0500616_0258892 3300053153 Bacteria 740
142 Ga0500649_000003 3300053722 Bacteria 140482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100004979 Ga0068856_10000497911 92
2 3300005577 Ga0068857_101598711 Ga0068857_1015987112 99
3 3300013308 Ga0157375_10645328 Ga0157375_106453282 99
4 3300050489 nmdc:mga03683_18038_c1 nmdc:mga03683_18038_c1_930_1283 99
5 3300050491 nmdc:mga00v17_8285_c1 nmdc:mga00v17_8285_c1_526_879 99
6 3300050491 nmdc:mga00v17_86756_c1 nmdc:mga00v17_86756_c1_863_1213 99
7 3300050492 nmdc:mga0yw44_538642_c1 nmdc:mga0yw44_538642_c1_176_529 99
8 3300050493 nmdc:mga0k408_15_c1 nmdc:mga0k408_15_c1_95079_95432 99
9 3300050516 nmdc:mga0sz30_334157_c1 nmdc:mga0sz30_334157_c1_188_538 99
10 3300010375 Ga0105239_10202327 Ga0105239_102023273 111
11 3300037418 Ga0395900_0699764 Ga0395900_0699764_229_564 111
12 3300003323 rootH1_10119277 rootH1_101192773 112
13 3300005329 Ga0070683_101211922 Ga0070683_1012119221 112
14 3300025944 Ga0207661_10975706 Ga0207661_109757062 112
15 3300005330 Ga0070690_101031659 Ga0070690_1010316591 114
16 3300009177 Ga0105248_10716472 Ga0105248_107164722 114
17 3300028666 Ga0265336_10000020 Ga0265336_10000020177 114
18 3300031240 Ga0265320_10109820 Ga0265320_101098202 114
19 3300031241 Ga0265325_10064875 Ga0265325_100648752 114
20 3300031344 Ga0265316_10512076 Ga0265316_105120762 114
21 3300031595 Ga0265313_10065471 Ga0265313_100654712 114
22 3300041496 Ga0451839_0751299 Ga0451839_0751299_10_354 114
23 3300053093 Ga0500651_0000011 Ga0500651_0000011_168588_168944 114
24 3300053093 Ga0500651_0017835 Ga0500651_0017835_3803_4159 114
25 3300053123 Ga0500614_000224 Ga0500614_000224_4175_4531 114
26 3300001915 JGI24741J21665_1001270 JGI24741J21665_10012707 115
27 3300001979 JGI24740J21852_10041047 JGI24740J21852_100410472 115
28 3300001990 JGI24737J22298_10000008 JGI24737J22298_1000000855 115
29 3300002067 JGI24735J21928_10000025 JGI24735J21928_1000002582 115
30 3300002244 JGI24742J22300_10000009 JGI24742J22300_100000095 115
31 3300003320 rootH2_10080305 rootH2_100803053 115
32 3300003323 rootH1_10196335 rootH1_101963352 115
33 3300005328 Ga0070676_10001177 Ga0070676_100011777 115
34 3300005329 Ga0070683_100001133 Ga0070683_1000011339 115
35 3300005334 Ga0068869_100443081 Ga0068869_1004430813 115
36 3300005355 Ga0070671_100559838 Ga0070671_1005598381 115
37 3300005530 Ga0070679_100371052 Ga0070679_1003710522 115
38 3300005535 Ga0070684_100000560 Ga0070684_10000056012 115
39 3300005539 Ga0068853_100020324 Ga0068853_1000203244 115
40 3300005563 Ga0068855_100000001 Ga0068855_100000001686 115
41 3300005577 Ga0068857_100005654 Ga0068857_10000565411 115
42 3300005577 Ga0068857_100049842 Ga0068857_1000498423 115
43 3300005577 Ga0068857_100270582 Ga0068857_1002705822 115
44 3300005614 Ga0068856_100000634 Ga0068856_10000063413 115
45 3300005614 Ga0068856_100435754 Ga0068856_1004357543 115
46 3300006038 Ga0075365_10001202 Ga0075365_1000120211 115
47 3300006042 Ga0075368_10000434 Ga0075368_100004343 115
48 3300006042 Ga0075368_10007501 Ga0075368_100075012 115
49 3300006048 Ga0075363_100000159 Ga0075363_1000001597 115
50 3300006051 Ga0075364_10000008 Ga0075364_1000000817 115
51 3300006051 Ga0075364_10000051 Ga0075364_1000005119 115
52 3300006051 Ga0075364_10013517 Ga0075364_100135173 115
53 3300006051 Ga0075364_10083124 Ga0075364_100831242 115
54 3300006051 Ga0075364_10154768 Ga0075364_101547682 115
55 3300006051 Ga0075364_10217125 Ga0075364_102171253 115
56 3300006051 Ga0075364_10740896 Ga0075364_107408962 115
57 3300006177 Ga0075362_10037855 Ga0075362_100378552 115
58 3300006177 Ga0075362_10431851 Ga0075362_104318512 115
59 3300006178 Ga0075367_10000038 Ga0075367_1000003814 115
60 3300006178 Ga0075367_10004582 Ga0075367_100045825 115
61 3300006178 Ga0075367_10145800 Ga0075367_101458002 115
62 3300006186 Ga0075369_10000102 Ga0075369_100001026 115
63 3300006186 Ga0075369_10346094 Ga0075369_103460942 115
64 3300006195 Ga0075366_10000002 Ga0075366_10000002154 115
65 3300006195 Ga0075366_10000004 Ga0075366_100000045 115
66 3300006195 Ga0075366_10000382 Ga0075366_100003822 115
67 3300006353 Ga0075370_10008124 Ga0075370_100081244 115
68 3300006353 Ga0075370_10438633 Ga0075370_104386332 115
69 3300009098 Ga0105245_12744918 Ga0105245_127449181 115
70 3300009174 Ga0105241_10000009 Ga0105241_1000000975 115
71 3300009979 Ga0105032_110979 Ga0105032_1109792 115
72 3300009993 Ga0105028_100603 Ga0105028_1006032 115
73 3300013104 Ga0157370_10167571 Ga0157370_101675712 115
74 3300013105 Ga0157369_10001636 Ga0157369_1000163626 115
75 3300013296 Ga0157374_10333043 Ga0157374_103330432 115
76 3300014325 Ga0163163_10006019 Ga0163163_100060198 115
77 3300025907 Ga0207645_10006038 Ga0207645_100060384 115
78 3300025911 Ga0207654_10000002 Ga0207654_10000002201 115
79 3300025913 Ga0207695_10020175 Ga0207695_100201753 115
80 3300025918 Ga0207662_10368902 Ga0207662_103689021 115
81 3300025921 Ga0207652_10315011 Ga0207652_103150112 115
82 3300025927 Ga0207687_11588360 Ga0207687_115883601 115
83 3300025935 Ga0207709_10016772 Ga0207709_100167721 115
84 3300025944 Ga0207661_10000412 Ga0207661_1000041211 115
85 3300025949 Ga0207667_10000003 Ga0207667_10000003674 115
86 3300026041 Ga0207639_10116108 Ga0207639_101161081 115
87 3300026078 Ga0207702_10877721 Ga0207702_108777212 115
88 3300026116 Ga0207674_10011548 Ga0207674_1001154810 115
89 3300026116 Ga0207674_10112405 Ga0207674_101124052 115
90 3300027866 Ga0209813_10000003 Ga0209813_1000000393 115
91 3300027866 Ga0209813_10002828 Ga0209813_100028287 115
92 3300028573 Ga0265334_10000502 Ga0265334_1000050211 115
93 3300028573 Ga0265334_10010801 Ga0265334_100108015 115
94 3300028573 Ga0265334_10015986 Ga0265334_100159862 115
95 3300028654 Ga0265322_10002362 Ga0265322_100023625 115
96 3300028800 Ga0265338_10000074 Ga0265338_1000007414 115
97 3300028800 Ga0265338_10000217 Ga0265338_1000021711 115
98 3300028800 Ga0265338_10000894 Ga0265338_100008949 115
99 3300028800 Ga0265338_10486898 Ga0265338_104868981 115
100 3300029957 Ga0265324_10006011 Ga0265324_100060114 115
101 3300029957 Ga0265324_10021306 Ga0265324_100213064 115
102 3300031241 Ga0265325_10283283 Ga0265325_102832831 115
103 3300031247 Ga0265340_10000983 Ga0265340_1000098311 115
104 3300031251 Ga0265327_10181413 Ga0265327_101814132 115
105 3300031344 Ga0265316_10004980 Ga0265316_100049809 115
106 3300031344 Ga0265316_11270512 Ga0265316_112705122 115
107 3300031711 Ga0265314_10032104 Ga0265314_100321045 115
108 3300031711 Ga0265314_10058988 Ga0265314_100589881 115
109 3300037418 Ga0395900_0353552 Ga0395900_0353552_95_442 115
110 3300041486 Ga0451807_2645929 Ga0451807_2645929_15_371 115
111 3300046557 Ga0495622_0000008 Ga0495622_0000008_162113_162514 115
112 3300046683 Ga0495658_0006102 Ga0495658_0006102_3850_4251 115
113 3300046692 Ga0495671_0137969 Ga0495671_0137969_560_967 115
114 3300046809 Ga0495600_0009146 Ga0495600_0009146_2552_2953 115
115 3300050489 nmdc:mga03683_48010_c1 nmdc:mga03683_48010_c1_941_1348 115
116 3300050490 nmdc:mga03n38_58_c1 nmdc:mga03n38_58_c1_10971_11378 115
117 3300050491 nmdc:mga00v17_138_c1 nmdc:mga00v17_138_c1_20912_21268 115
118 3300050491 nmdc:mga00v17_15339_c2 nmdc:mga00v17_15339_c2_1443_1820 115
119 3300050492 nmdc:mga0yw44_97_c1 nmdc:mga0yw44_97_c1_17045_17401 115
120 3300050493 nmdc:mga0k408_11_c1 nmdc:mga0k408_11_c1_88196_88573 115
121 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_164939_165340 115
122 3300050493 nmdc:mga0k408_264_c1 nmdc:mga0k408_264_c1_22129_22527 115
123 3300050493 nmdc:mga0k408_271310_c1 nmdc:mga0k408_271310_c1_125_532 115
124 3300050493 nmdc:mga0k408_362_c1 nmdc:mga0k408_362_c1_4158_4514 115
125 3300050494 nmdc:mga06z11_2_c1 nmdc:mga06z11_2_c1_84735_85142 115
126 3300050494 nmdc:mga06z11_349272_c1 nmdc:mga06z11_349272_c1_424_780 115
127 3300050494 nmdc:mga06z11_55_c1 nmdc:mga06z11_55_c1_17115_17471 115
128 3300050495 nmdc:mga04h51_3325_c1 nmdc:mga04h51_3325_c1_3244_3600 115
129 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_122755_123162 115
130 3300050496 nmdc:mga07m45_389712_c1 nmdc:mga07m45_389712_c1_335_736 115
131 3300050496 nmdc:mga07m45_939_c1 nmdc:mga07m45_939_c1_12237_12644 115
132 3300050516 nmdc:mga0sz30_12_c1 nmdc:mga0sz30_12_c1_52899_53300 115
133 3300050516 nmdc:mga0sz30_315729_c1 nmdc:mga0sz30_315729_c1_231_632 115
134 3300053094 Ga0500566_0000001 Ga0500566_0000001_130752_131153 115
135 3300053104 Ga0500556_0000506 Ga0500556_0000506_12750_13160 115
136 3300053118 Ga0500594_0142915 Ga0500594_0142915_152_529 115
137 3300053123 Ga0500614_000001 Ga0500614_000001_878256_878654 115
138 3300053123 Ga0500614_004187 Ga0500614_004187_2354_2755 115
139 3300053141 Ga0500574_110141 Ga0500574_110141_107_508 115
140 3300053151 Ga0500604_0078989 Ga0500604_0078989_250_648 115
141 3300053153 Ga0500616_0258892 Ga0500616_0258892_363_713 115
142 3300053722 Ga0500649_000003 Ga0500649_000003_28169_28567 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

3

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.9293 3 115
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.9261 3 115
6ov1-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity 0.9016 4 114
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.8954 3 115
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.8911 3 115
ID Description Score Start End Superfamily
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9261 3 115 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9115 1 110 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8954 3 115 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8837 6 115 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8664 1 110 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A2M8KZE2-F1-model_v4 Ribonuclease P protein component (EC 3.1.26.5) 0.9963 1 94 GO:0000049
GO:0004526
GO:0030677
GO:0042781
AF-A0A5C7J840-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.996 1 114 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A431HKQ5-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9927 1 115 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A5C7J840-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9873 1 114 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A2M8KZE2-F1-model_v4 Ribonuclease P protein component (EC 3.1.26.5) 0.9858 1 94 GO:0000049
GO:0004526
GO:0030677
GO:0042781

Feature Viewer

pLDDT pTM Quality
90.08 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map