F182718

General Info

Members Datasets Scaffolds Average Seq Length
141 86 282 195

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10492625|Ga0157376_104926252
Length 210
Sequence MPTRTQLRKENLRMNDQPAPHDPLLLDHEYDGIRELDNKLPRWWVWLFNLSILFAVLYMVYYHVLGKGQLMAAQYQEEMQFGEQAKSKAIAAFETSMGALEPSQDAVVLAQGKDTFSKLCAPCHRVDAGGLVGPNLCDDYWIHGSNFVDNLKTIWNGVPAKGMVTWKTTLKPDTIFAVGSYIYTLRGTHPANPKPPENTAPVKTGPSEFE

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
41 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
48 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
52 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
53 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
54 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
74 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 27.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10492625 3300014969 Bacteria 1203
2 rootH2_10305562 3300003320 Bacteria 1077
3 Ga0070658_10165230 3300005327 Unclassified 1858
4 Ga0070660_100271813 3300005339 Unclassified 1385
5 Ga0070689_100231665 3300005340 Bacteria 1518
6 Ga0070688_100362454 3300005365 Bacteria 1064
7 Ga0070688_100509263 3300005365 Unclassified 909
8 Ga0070714_100042583 3300005435 Bacteria 3837
9 Ga0070711_100168763 3300005439 Bacteria 1666
10 Ga0070685_10739711 3300005466 Bacteria 720
11 Ga0070679_100385903 3300005530 Unclassified 1347
12 Ga0070684_101140399 3300005535 Unclassified 733
13 Ga0068855_100223619 3300005563 Bacteria 2110
14 Ga0068856_100163694 3300005614 Bacteria 2236
15 Ga0070702_100814390 3300005615 Unclassified 723
16 Ga0068864_100455961 3300005618 Bacteria 1223
17 Ga0068864_101734326 3300005618 Unclassified 629
18 Ga0068863_100264037 3300005841 Unclassified 1665
19 Ga0068863_100461227 3300005841 Bacteria 1248
20 Ga0070715_10423373 3300006163 Unclassified 745
21 Ga0097621_100525931 3300006237 Unclassified 1074
22 Ga0105251_10230771 3300009011 Bacteria 833
23 Ga0105240_10002833 3300009093 Bacteria 27427
24 Ga0105240_10319623 3300009093 Bacteria 1770
25 Ga0105240_10509241 3300009093 Bacteria 1337
26 Ga0105241_10665550 3300009174 Bacteria 947
27 Ga0105237_10480923 3300009545 Bacteria 1248
28 Ga0105238_10002871 3300009551 Bacteria 17224
29 Ga0105238_10056264 3300009551 Bacteria 3947
30 Ga0157374_10255941 3300013296 Bacteria 1723
31 Ga0157374_10699023 3300013296 Bacteria 1027
32 Ga0157374_11226817 3300013296 Unclassified 771
33 Ga0157378_10227997 3300013297 Bacteria 1774
34 Ga0157372_10228477 3300013307 Unclassified 2157
35 Ga0157375_10000045 3300013308 Bacteria 151387
36 Ga0163163_10000027 3300014325 Bacteria 176970
37 Ga0163163_10059765 3300014325 Bacteria 3772
38 Ga0163163_10511991 3300014325 Unclassified 1262
39 Ga0163163_10607443 3300014325 Bacteria 1157
40 Ga0163163_10995949 3300014325 Bacteria 901
41 Ga0157379_10068933 3300014968 Bacteria 3162
42 Ga0157379_11043670 3300014968 Bacteria 781
43 Ga0157376_10104374 3300014969 Bacteria 2483
44 Ga0157376_10557778 3300014969 Unclassified 1134
45 Ga0163161_10470741 3300017792 Unclassified 1019
46 Ga0207695_10071260 3300025913 Bacteria 3550
47 Ga0207695_10665869 3300025913 Unclassified 922
48 Ga0207694_10102653 3300025924 Bacteria 2267
49 Ga0207659_10732796 3300025926 Bacteria 847
50 Ga0207700_10216370 3300025928 Unclassified 1622
51 Ga0207664_10030950 3300025929 Bacteria 4091
52 Ga0207667_10274220 3300025949 Unclassified 1724
53 Ga0207703_10493730 3300026035 Bacteria 1148
54 Ga0207641_10415655 3300026088 Bacteria 1294
55 Ga0207676_10267362 3300026095 Bacteria 1547
56 Ga0265337_1022248 3300028556 Bacteria 1966
57 Ga0265337_1080368 3300028556 Unclassified 892
58 Ga0265326_10009884 3300028558 Bacteria 2847
59 Ga0265334_10009158 3300028573 Bacteria 4195
60 Ga0265338_10000032 3300028800 Bacteria 257580
61 Ga0265338_10000640 3300028800 Bacteria 60543
62 Ga0265338_10001863 3300028800 Bacteria 33129
63 Ga0265338_10005931 3300028800 Bacteria 15736
64 Ga0265338_10008388 3300028800 Bacteria 12552
65 Ga0265338_10011231 3300028800 Bacteria 10375
66 Ga0265338_10040891 3300028800 Bacteria 4346
67 Ga0265338_10162228 3300028800 Bacteria 1725
68 Ga0265338_10360110 3300028800 Unclassified 1044
69 Ga0265324_10000434 3300029957 Bacteria 29709
70 Ga0265324_10083320 3300029957 Bacteria 1088
71 Ga0265332_10011503 3300031238 Bacteria 3932
72 Ga0265320_10023259 3300031240 Bacteria 3301
73 Ga0265320_10172408 3300031240 Unclassified 972
74 Ga0265329_10009587 3300031242 Unclassified 3600
75 Ga0265339_10023177 3300031249 Bacteria 3591
76 Ga0265339_10032424 3300031249 Unclassified 2946
77 Ga0265339_10098348 3300031249 Bacteria 1526
78 Ga0265316_10071902 3300031344 Unclassified 2666
79 Ga0265314_10000154 3300031711 Bacteria 103219
80 Ga0265314_10123920 3300031711 Bacteria 1622
81 Ga0265314_10174578 3300031711 Unclassified 1294
82 Ga0373926_0092507 3300035083 Bacteria 1125
83 Ga0373936_0171642 3300035113 Bacteria 948
84 Ga0373946_0219572 3300035171 Bacteria 917
85 Ga0373924_0185016 3300035410 Bacteria 917
86 Ga0373935_0105280 3300035692 Bacteria 1865
87 Ga0373927_0034848 3300035695 Unclassified 3273
88 Ga0373947_0014561 3300035725 Bacteria 4512
89 Ga0373937_0117772 3300036401 Unclassified 2474
90 Ga0373937_0523239 3300036401 Bacteria 1127
91 Ga0373937_0577790 3300036401 Unclassified 1067
92 Ga0373937_0782711 3300036401 Bacteria 902
93 Ga0373925_0003103 3300037068 Bacteria 13032
94 Ga0373925_0424092 3300037068 Unclassified 1087
95 Ga0451849_1162802 3300041505 Bacteria 1197
96 Ga0451577_0001255 3300042876 Bacteria 35069
97 Ga0451577_0196812 3300042876 Bacteria 1819
98 Ga0451577_0722615 3300042876 Unclassified 901
99 Ga0453684_0004472 3300044712 Bacteria 29443
100 Ga0453684_0007500 3300044712 Bacteria 20010
101 Ga0451576_0085464 3300045051 Bacteria 3282
102 Ga0451576_0118517 3300045051 Bacteria 2756
103 Ga0451576_0237675 3300045051 Bacteria 1903
104 Ga0451576_0404023 3300045051 Bacteria 1432
105 Ga0451576_0701607 3300045051 Bacteria 1063
106 Ga0451576_0719054 3300045051 Unclassified 1049
107 Ga0495641_0011688 3300046461 Bacteria 4974
108 Ga0495582_0079627 3300046473 Unclassified 1819
109 Ga0495662_0021688 3300046476 Bacteria 3103
110 Ga0495630_0000231 3300046517 Bacteria 44405
111 Ga0495630_0025065 3300046517 Bacteria 4409
112 Ga0495630_0742694 3300046517 Unclassified 750
113 Ga0495666_0061219 3300046526 Bacteria 1799
114 Ga0495666_0117142 3300046526 Unclassified 1249
115 Ga0495586_0000009 3300046535 Bacteria 144639
116 Ga0495586_0000756 3300046535 Bacteria 18567
117 Ga0495645_0516176 3300046543 Unclassified 745
118 Ga0495634_0003123 3300046642 Bacteria 13469
119 Ga0495634_0036963 3300046642 Bacteria 3338
120 Ga0495658_0005648 3300046683 Bacteria 6146
121 Ga0495613_0022489 3300046689 Bacteria 4697
122 Ga0495676_0006284 3300047321 Bacteria 10932
123 Ga0495676_0088794 3300047321 Bacteria 2317
124 Ga0495676_0151731 3300047321 Bacteria 1648
125 Ga0495684_0467002 3300047471 Unclassified 874
126 Ga0501031_0000039 3300049568 Bacteria 72794
127 Ga0501031_0452884 3300049568 Bacteria 829
128 Ga0501032_0045076 3300049569 Bacteria 2984
129 Ga0501032_0941508 3300049569 Unclassified 543
130 Ga0501033_0002435 3300049570 Bacteria 15815
131 Ga0501033_0220274 3300049570 Bacteria 1351
132 Ga0501036_0627376 3300049572 Bacteria 891
133 Ga0501037_0335686 3300049573 Bacteria 1045
134 Ga0501038_0878619 3300049574 Unclassified 663
135 Ga0501039_0440598 3300049575 Bacteria 1023
136 Ga0501043_0278618 3300049579 Bacteria 1282
137 Ga0501046_0303821 3300049580 Bacteria 1165
138 Ga0501046_0578198 3300049580 Unclassified 799
139 Ga0501035_0003612 3300049822 Bacteria 14764
140 Ga0501044_0000133 3300049823 Bacteria 91116
141 Ga0501044_0212491 3300049823 Bacteria 1888
142 Ga0157376_10492625
143 rootH2_10305562
144 Ga0070658_10165230
145 Ga0070660_100271813
146 Ga0070689_100231665
147 Ga0070688_100362454
148 Ga0070688_100509263
149 Ga0070714_100042583
150 Ga0070711_100168763
151 Ga0070685_10739711
152 Ga0070679_100385903
153 Ga0070684_101140399
154 Ga0068855_100223619
155 Ga0068856_100163694
156 Ga0070702_100814390
157 Ga0068864_100455961
158 Ga0068864_101734326
159 Ga0068863_100264037
160 Ga0068863_100461227
161 Ga0070715_10423373
162 Ga0097621_100525931
163 Ga0105251_10230771
164 Ga0105240_10002833
165 Ga0105240_10319623
166 Ga0105240_10509241
167 Ga0105241_10665550
168 Ga0105237_10480923
169 Ga0105238_10002871
170 Ga0105238_10056264
171 Ga0157374_10255941
172 Ga0157374_10699023
173 Ga0157374_11226817
174 Ga0157378_10227997
175 Ga0157372_10228477
176 Ga0157375_10000045
177 Ga0163163_10000027
178 Ga0163163_10059765
179 Ga0163163_10511991
180 Ga0163163_10607443
181 Ga0163163_10995949
182 Ga0157379_10068933
183 Ga0157379_11043670
184 Ga0157376_10104374
185 Ga0157376_10557778
186 Ga0163161_10470741
187 Ga0207695_10071260
188 Ga0207695_10665869
189 Ga0207694_10102653
190 Ga0207659_10732796
191 Ga0207700_10216370
192 Ga0207664_10030950
193 Ga0207667_10274220
194 Ga0207703_10493730
195 Ga0207641_10415655
196 Ga0207676_10267362
197 Ga0265337_1022248
198 Ga0265337_1080368
199 Ga0265326_10009884
200 Ga0265334_10009158
201 Ga0265338_10000032
202 Ga0265338_10000640
203 Ga0265338_10001863
204 Ga0265338_10005931
205 Ga0265338_10008388
206 Ga0265338_10011231
207 Ga0265338_10040891
208 Ga0265338_10162228
209 Ga0265338_10360110
210 Ga0265324_10000434
211 Ga0265324_10083320
212 Ga0265332_10011503
213 Ga0265320_10023259
214 Ga0265320_10172408
215 Ga0265329_10009587
216 Ga0265339_10023177
217 Ga0265339_10032424
218 Ga0265339_10098348
219 Ga0265316_10071902
220 Ga0265314_10000154
221 Ga0265314_10123920
222 Ga0265314_10174578
223 Ga0373926_0092507
224 Ga0373936_0171642
225 Ga0373946_0219572
226 Ga0373924_0185016
227 Ga0373935_0105280
228 Ga0373927_0034848
229 Ga0373947_0014561
230 Ga0373937_0117772
231 Ga0373937_0523239
232 Ga0373937_0577790
233 Ga0373937_0782711
234 Ga0373925_0003103
235 Ga0373925_0424092
236 Ga0451849_1162802
237 Ga0451577_0001255
238 Ga0451577_0196812
239 Ga0451577_0722615
240 Ga0453684_0004472
241 Ga0453684_0007500
242 Ga0451576_0085464
243 Ga0451576_0118517
244 Ga0451576_0237675
245 Ga0451576_0404023
246 Ga0451576_0701607
247 Ga0451576_0719054
248 Ga0495641_0011688
249 Ga0495582_0079627
250 Ga0495662_0021688
251 Ga0495630_0000231
252 Ga0495630_0025065
253 Ga0495630_0742694
254 Ga0495666_0061219
255 Ga0495666_0117142
256 Ga0495586_0000009
257 Ga0495586_0000756
258 Ga0495645_0516176
259 Ga0495634_0003123
260 Ga0495634_0036963
261 Ga0495658_0005648
262 Ga0495613_0022489
263 Ga0495676_0006284
264 Ga0495676_0088794
265 Ga0495676_0151731
266 Ga0495684_0467002
267 Ga0501031_0000039
268 Ga0501031_0452884
269 Ga0501032_0045076
270 Ga0501032_0941508
271 Ga0501033_0002435
272 Ga0501033_0220274
273 Ga0501036_0627376
274 Ga0501037_0335686
275 Ga0501038_0878619
276 Ga0501039_0440598
277 Ga0501043_0278618
278 Ga0501046_0303821
279 Ga0501046_0578198
280 Ga0501035_0003612
281 Ga0501044_0000133
282 Ga0501044_0212491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14715

FixP_N

N-terminal domain of cytochrome oxidase-cbb3, FixP

23

69

0.95

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

107

182

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c90-assembly1.cif.gz_C crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.9015 87 167
6rte-assembly2.cif.gz_B dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.8791 94 166
6rte-assembly1.cif.gz_A dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.8628 94 166
2d0w-assembly2.cif.gz_B crystal structure of cytochrome cl from hyphomicrobium denitrificans 0.8461 91 169
7y5e-assembly1.cif.gz_GN in situ single-pbs-psii-psi-lhcs megacomplex. 0.8393 92 167
ID Description Score Start End Superfamily
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8461 91 169 1.10.760.10
2zboK00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8404 92 167 1.10.760.10
1mg2H00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8389 88 169 1.10.760.10
4eicA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8222 92 171 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8221 94 171 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A6H9LP74-F1-model_v4 Cytochrome c domain-containing protein 0.9359 83 180 GO:0009055
GO:0020037
GO:0046872
AF-A0A4Q3X175-F1-model_v4 deleted 0.9314 88 180
AF-A0A7V9JU03-F1-model_v4 C-type cytochrome 0.9295 87 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A3M2FSM0-F1-model_v4 Cytochrome c domain-containing protein 0.9283 83 180 GO:0009055
GO:0020037
GO:0046872
AF-A6DTF0-F1-model_v4 Cytochrome-c oxidase fixP chain 0.9272 90 169 GO:0009055
GO:0020037
GO:0046872

Map