F179385

General Info

Members Datasets Scaffolds Average Seq Length
140 98 280 264

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10286710|Ga0111539_102867102
Length 293
Sequence VRQAPTPLAVPDAQKLAGDSAFTHLAKPFMKTNHVRAKLKRGEPSVGTWLTLPDVVAARLMARVGFDWLTVELEHTPVNFETAANSFAIVSACNVAPLARVPWNTGENIKRVLDTGAWGVVVPMVNSKAEAEAAVAFSRYAPLGQRSIGGQMHAANFDTDPGTYYAKANDEILLVLMAEHVDAIERADEIMSVPGIDVIFIGPNDLHNSMGKAPAFDSEHKEFVDAVQHVLKTARKRGIAAGIHVLDSAQAKRRIAEGFQFIAITSEAGMMLAKAQEIAGALGLGAGKAVAKY

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
49 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
79 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
97 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 2.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.29
Nodule 0
Rhizoplane 2.14
Rhizosphere 92.14
Stem 0
Stem Tuber 0
Unclassified 27.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10286710 3300009094 Bacteria 1916
2 Ga0055526_1039937 3300003771 Bacteria 1189
3 Ga0065704_10114228 3300005289 Bacteria 1893
4 Ga0070683_100131011 3300005329 Unclassified 2373
5 Ga0070689_100016799 3300005340 Bacteria 5362
6 Ga0070688_100083694 3300005365 Unclassified 2071
7 Ga0070714_100264382 3300005435 Bacteria 1594
8 Ga0070714_100557063 3300005435 Bacteria 1098
9 Ga0070713_100125228 3300005436 Bacteria 2259
10 Ga0070701_10005286 3300005438 Bacteria 5318
11 Ga0070705_100052656 3300005440 Bacteria 2379
12 Ga0070694_100006728 3300005444 Bacteria 6982
13 Ga0070708_100066583 3300005445 Bacteria 3234
14 Ga0070708_100379152 3300005445 Bacteria 1333
15 Ga0070708_100708298 3300005445 Unclassified 947
16 Ga0070706_100009769 3300005467 Bacteria 8914
17 Ga0070706_100021055 3300005467 Bacteria 6003
18 Ga0070706_100095729 3300005467 Bacteria 2756
19 Ga0070707_100024161 3300005468 Bacteria 5753
20 Ga0070707_100038783 3300005468 Bacteria 4551
21 Ga0070707_100734560 3300005468 Unclassified 950
22 Ga0070698_100055233 3300005471 Bacteria 4028
23 Ga0070698_100119285 3300005471 Unclassified 2599
24 Ga0070698_100717213 3300005471 Unclassified 942
25 Ga0070699_100012418 3300005518 Bacteria 7349
26 Ga0070699_100062863 3300005518 Bacteria 3218
27 Ga0070697_100360181 3300005536 Bacteria 1257
28 Ga0068853_100234913 3300005539 Unclassified 1678
29 Ga0070686_100004735 3300005544 Bacteria 7504
30 Ga0070686_100011062 3300005544 Bacteria 5110
31 Ga0070686_100071409 3300005544 Unclassified 2272
32 Ga0070665_100002035 3300005548 Bacteria 22756
33 Ga0070665_100367961 3300005548 Bacteria 1444
34 Ga0070704_100009031 3300005549 Bacteria 6009
35 Ga0070704_100227558 3300005549 Unclassified 1519
36 Ga0070704_100589759 3300005549 Unclassified 975
37 Ga0068859_100053995 3300005617 Bacteria 4041
38 Ga0081540_1102620 3300005983 Unclassified 1228
39 Ga0070717_10017912 3300006028 Bacteria 5524
40 Ga0070712_100627927 3300006175 Unclassified 911
41 Ga0075362_10186965 3300006177 Bacteria 1005
42 Ga0075428_100001677 3300006844 Bacteria 23594
43 Ga0075428_100239499 3300006844 Bacteria 1958
44 Ga0097620_100053995 3300006931 Bacteria 4041
45 Ga0111539_10089106 3300009094 Unclassified 3625
46 Ga0111539_10116135 3300009094 Bacteria 3138
47 Ga0111539_10181559 3300009094 Bacteria 2457
48 Ga0111539_10303417 3300009094 Unclassified 1858
49 Ga0111539_10333761 3300009094 Bacteria 1765
50 Ga0105247_10128255 3300009101 Unclassified 1651
51 Ga0114129_10454645 3300009147 Bacteria 1679
52 Ga0114129_10912150 3300009147 Bacteria 1112
53 Ga0105242_10081732 3300009176 Unclassified 2702
54 Ga0105248_10087297 3300009177 Unclassified 3510
55 Ga0157372_10961011 3300013307 Bacteria 990
56 Ga0197907_10415379 3300020069 Bacteria 1337
57 Ga0206351_10294475 3300020077 Bacteria 1218
58 Ga0206350_10137591 3300020080 Bacteria 2505
59 Ga0224712_10054553 3300022467 Unclassified 1569
60 Ga0209257_1000919 3300025304 Bacteria 40996
61 Ga0207684_10018949 3300025910 Bacteria 5887
62 Ga0207684_10034501 3300025910 Bacteria 4299
63 Ga0207684_10120504 3300025910 Bacteria 2249
64 Ga0207693_10151185 3300025915 Bacteria 1826
65 Ga0207646_10021432 3300025922 Bacteria 5970
66 Ga0207646_10027082 3300025922 Bacteria 5227
67 Ga0207646_10058445 3300025922 Bacteria 3444
68 Ga0207664_10188594 3300025929 Bacteria 1774
69 Ga0207686_10646159 3300025934 Unclassified 837
70 Ga0207670_10003595 3300025936 Bacteria 8223
71 Ga0207670_10004164 3300025936 Bacteria 7756
72 Ga0207661_10110910 3300025944 Unclassified 2320
73 Ga0265319_1015510 3300028563 Bacteria 2953
74 Ga0265338_10008855 3300028800 Bacteria 12136
75 Ga0265338_10033206 3300028800 Bacteria 5013
76 Ga0265338_10066077 3300028800 Bacteria 3132
77 Ga0265328_10012214 3300031239 Unclassified 3420
78 Ga0265329_10017407 3300031242 Unclassified 2473
79 Ga0265331_10000239 3300031250 Bacteria 66016
80 Ga0265314_10000730 3300031711 Bacteria 39549
81 Ga0265314_10000760 3300031711 Bacteria 38593
82 Ga0307510_10001843 3300033180 Bacteria 23753
83 Ga0373944_0056705 3300035089 Unclassified 1247
84 Ga0373956_0000196 3300035119 Bacteria 23332
85 Ga0373955_0062747 3300035172 Unclassified 2056
86 Ga0373927_0000120 3300035695 Bacteria 59583
87 Ga0395900_0079946 3300037418 Unclassified 3360
88 Ga0395905_0067633 3300037471 Unclassified 3346
89 Ga0395905_0346944 3300037471 Unclassified 1376
90 Ga0395901_0156022 3300038443 Unclassified 2398
91 Ga0436363_0976593 3300039450 Bacteria 12720
92 Ga0466969_0000376 3300044656 Bacteria 24498
93 Ga0466972_0008747 3300044658 Bacteria 5080
94 Ga0466965_0041396 3300044683 Bacteria 2270
95 Ga0466966_0002615 3300044684 Bacteria 11799
96 Ga0466964_0000132 3300044706 Bacteria 19490
97 Ga0466968_0000157 3300044735 Bacteria 20655
98 Ga0466970_0000288 3300044765 Bacteria 24601
99 Ga0466957_0009141 3300044842 Bacteria 5653
100 Ga0466959_0003621 3300045049 Bacteria 10191
101 Ga0451576_0027234 3300045051 Bacteria 6142
102 Ga0451576_0080924 3300045051 Bacteria 3379
103 Ga0451576_0192703 3300045051 Bacteria 2129
104 Ga0451576_0453770 3300045051 Unclassified 1346
105 Ga0451576_0773749 3300045051 Unclassified 1008
106 Ga0466958_0234901 3300045836 Bacteria 1171
107 Ga0495610_0002446 3300046512 Bacteria 15615
108 Ga0495642_0001814 3300046528 Bacteria 9154
109 Ga0495668_0002510 3300046616 Bacteria 14995
110 Ga0495611_0014493 3300046648 Bacteria 3368
111 Ga0495658_0069198 3300046683 Bacteria 2045
112 Ga0495672_0213480 3300047320 Bacteria 957
113 Ga0495677_0013085 3300047445 Bacteria 3019
114 Ga0496106_0184257 3300048909 Unclassified 1658
115 Ga0496110_0293038 3300048913 Bacteria 1482
116 Ga0496111_0380735 3300048914 Unclassified 1043
117 Ga0495678_003608 3300049459 Bacteria 9438
118 Ga0501034_0096118 3300049571 Bacteria 2959
119 Ga0501034_0362310 3300049571 Unclassified 1377
120 Ga0501037_0089739 3300049573 Unclassified 2224
121 Ga0501039_0196683 3300049575 Bacteria 1585
122 Ga0501039_0400965 3300049575 Bacteria 1077
123 Ga0501047_0222484 3300049581 Unclassified 1743
124 Ga0501047_0472667 3300049581 Bacteria 1082
125 Ga0501071_0095702 3300049587 Bacteria 2185
126 Ga0501073_0031786 3300049589 Unclassified 3766
127 Ga0501073_0152761 3300049589 Bacteria 1600
128 Ga0501080_0162294 3300049742 Bacteria 2063
129 Ga0501083_0076273 3300049744 Bacteria 2225
130 Ga0501044_0001077 3300049823 Bacteria 32602
131 Ga0501044_0508878 3300049823 Bacteria 1105
132 nmdc:mga03683_49905_c1 3300050489 Bacteria 1743
133 nmdc:mga06r32_251759_c1 3300050510 Unclassified 1754
134 nmdc:mga08y16_652525_c1 3300050511 Bacteria 1056
135 nmdc:mga08y16_97754_c1 3300050511 Bacteria 3057
136 nmdc:mga0rr50_51532_c1 3300050513 Unclassified 3054
137 Ga0500578_0000005 3300053086 Bacteria 243789
138 Ga0500594_0000392 3300053118 Bacteria 9765
139 Ga0501082_0112184 3300060353 Bacteria 2361
140 Ga0501082_0364363 3300060353 Unclassified 1261
141 Ga0111539_10286710
142 Ga0055526_1039937
143 Ga0065704_10114228
144 Ga0070683_100131011
145 Ga0070689_100016799
146 Ga0070688_100083694
147 Ga0070714_100264382
148 Ga0070714_100557063
149 Ga0070713_100125228
150 Ga0070701_10005286
151 Ga0070705_100052656
152 Ga0070694_100006728
153 Ga0070708_100066583
154 Ga0070708_100379152
155 Ga0070708_100708298
156 Ga0070706_100009769
157 Ga0070706_100021055
158 Ga0070706_100095729
159 Ga0070707_100024161
160 Ga0070707_100038783
161 Ga0070707_100734560
162 Ga0070698_100055233
163 Ga0070698_100119285
164 Ga0070698_100717213
165 Ga0070699_100012418
166 Ga0070699_100062863
167 Ga0070697_100360181
168 Ga0068853_100234913
169 Ga0070686_100004735
170 Ga0070686_100011062
171 Ga0070686_100071409
172 Ga0070665_100002035
173 Ga0070665_100367961
174 Ga0070704_100009031
175 Ga0070704_100227558
176 Ga0070704_100589759
177 Ga0068859_100053995
178 Ga0081540_1102620
179 Ga0070717_10017912
180 Ga0070712_100627927
181 Ga0075362_10186965
182 Ga0075428_100001677
183 Ga0075428_100239499
184 Ga0097620_100053995
185 Ga0111539_10089106
186 Ga0111539_10116135
187 Ga0111539_10181559
188 Ga0111539_10303417
189 Ga0111539_10333761
190 Ga0105247_10128255
191 Ga0114129_10454645
192 Ga0114129_10912150
193 Ga0105242_10081732
194 Ga0105248_10087297
195 Ga0157372_10961011
196 Ga0197907_10415379
197 Ga0206351_10294475
198 Ga0206350_10137591
199 Ga0224712_10054553
200 Ga0209257_1000919
201 Ga0207684_10018949
202 Ga0207684_10034501
203 Ga0207684_10120504
204 Ga0207693_10151185
205 Ga0207646_10021432
206 Ga0207646_10027082
207 Ga0207646_10058445
208 Ga0207664_10188594
209 Ga0207686_10646159
210 Ga0207670_10003595
211 Ga0207670_10004164
212 Ga0207661_10110910
213 Ga0265319_1015510
214 Ga0265338_10008855
215 Ga0265338_10033206
216 Ga0265338_10066077
217 Ga0265328_10012214
218 Ga0265329_10017407
219 Ga0265331_10000239
220 Ga0265314_10000730
221 Ga0265314_10000760
222 Ga0307510_10001843
223 Ga0373944_0056705
224 Ga0373956_0000196
225 Ga0373955_0062747
226 Ga0373927_0000120
227 Ga0395900_0079946
228 Ga0395905_0067633
229 Ga0395905_0346944
230 Ga0395901_0156022
231 Ga0436363_0976593
232 Ga0466969_0000376
233 Ga0466972_0008747
234 Ga0466965_0041396
235 Ga0466966_0002615
236 Ga0466964_0000132
237 Ga0466968_0000157
238 Ga0466970_0000288
239 Ga0466957_0009141
240 Ga0466959_0003621
241 Ga0451576_0027234
242 Ga0451576_0080924
243 Ga0451576_0192703
244 Ga0451576_0453770
245 Ga0451576_0773749
246 Ga0466958_0234901
247 Ga0495610_0002446
248 Ga0495642_0001814
249 Ga0495668_0002510
250 Ga0495611_0014493
251 Ga0495658_0069198
252 Ga0495672_0213480
253 Ga0495677_0013085
254 Ga0496106_0184257
255 Ga0496110_0293038
256 Ga0496111_0380735
257 Ga0495678_003608
258 Ga0501034_0096118
259 Ga0501034_0362310
260 Ga0501037_0089739
261 Ga0501039_0196683
262 Ga0501039_0400965
263 Ga0501047_0222484
264 Ga0501047_0472667
265 Ga0501071_0095702
266 Ga0501073_0031786
267 Ga0501073_0152761
268 Ga0501080_0162294
269 Ga0501083_0076273
270 Ga0501044_0001077
271 Ga0501044_0508878
272 nmdc:mga03683_49905_c1
273 nmdc:mga06r32_251759_c1
274 nmdc:mga08y16_652525_c1
275 nmdc:mga08y16_97754_c1
276 nmdc:mga0rr50_51532_c1
277 Ga0500578_0000005
278 Ga0500594_0000392
279 Ga0501082_0112184
280 Ga0501082_0364363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

45

274

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nr1-assembly1.cif.gz_A crystal structure of holo-s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 0.9629 3 252
7o5w-assembly1.cif.gz_BBB crystal structure of holo-f210w mutant of hydroxy ketone aldolase (swhka)from sphingomonas wittichii rw1 0.961 1 251
7o5i-assembly1.cif.gz_A crystal structure of apo-swhka (hydroxy ketone aldolase) from sphingomonas wittichii rw1 0.9597 2 251
7nnk-assembly1.cif.gz_B crystal structure of s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 in complex with hydroxypyruvate 0.9528 1 251
7nr1-assembly1.cif.gz_A crystal structure of holo-s116a mutant of hydroxy ketone aldolase (swhka) from sphingomonas wittichii rw1 0.9517 3 252
ID Description Score Start End Superfamily
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9595 1 251 3.20.20.60
6r62A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9484 1 251 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9449 1 251 3.20.20.60
af_Q4CQY1_6_194_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9391 6 179 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9306 2 251 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A4R0Y8P5-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.983 1 251 GO:0005737
GO:0016832
AF-A0A504ANM8-F1-model_v4 deleted 0.9815 1 256
AF-A0A7W1YQ24-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9794 2 253 GO:0005737
GO:0016832
AF-Q133D0-F1-model_v4 HpcH/HpaI aldolase 0.9749 42 258 GO:0005737
GO:0016832
AF-A0A537T2B7-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase 0.9747 1 258 GO:0005737
GO:0016832

Map