F179062

General Info

Members Datasets Scaffolds Average Seq Length
140 97 140 163

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1006614|Ga0081540_10066143
Length 194
Sequence MEKASNSAGNGTAAKQPSSFLMVCLGNICRSPLAEGILQEKARAAGLDWTIDSAGTNGYHVGEAPHHLSQKVARYNGIDISRQRARRFTGADFQRFDKIYAMAGDVIDDMRRIAGRHGLRLTGVPGSTSPLSFAVLGYSSKVELLMNEVHPGHDADVPDPYYGPESDYYEVYQMIETAADRIIAKYGKHTTQKA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
76 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
85 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
89 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
90 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
91 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
94 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
95 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
96 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
97 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 0
Rhizosphere 82.86
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10341030 3300003320 Unclassified 1469
2 rootH1_10073862 3300003323 Bacteria 2938
3 rootH1_10094731 3300003323 Bacteria 1260
4 Ga0065714_10079897 3300005288 Bacteria 2476
5 Ga0065712_10094549 3300005290 Bacteria 2241
6 Ga0065712_10308989 3300005290 Bacteria 847
7 Ga0070683_100010084 3300005329 Bacteria 8104
8 Ga0070670_100055315 3300005331 Unclassified 3406
9 Ga0070670_100240753 3300005331 Bacteria 1575
10 Ga0070670_100847711 3300005331 Bacteria 827
11 Ga0070677_10245317 3300005333 Unclassified 886
12 Ga0070666_10269541 3300005335 Bacteria 1208
13 Ga0070666_10842509 3300005335 Bacteria 676
14 Ga0070661_100730842 3300005344 Unclassified 808
15 Ga0070675_100402355 3300005354 Unclassified 1221
16 Ga0070671_101424530 3300005355 Bacteria 612
17 Ga0070674_101164430 3300005356 Bacteria 683
18 Ga0070688_100358778 3300005365 Bacteria 1069
19 Ga0070667_100454931 3300005367 Bacteria 1170
20 Ga0070663_100255992 3300005455 Bacteria 1387
21 Ga0070684_100026999 3300005535 Unclassified 4842
22 Ga0070684_100028065 3300005535 Bacteria 4758
23 Ga0068853_100089153 3300005539 Bacteria 2709
24 Ga0070665_100000094 3300005548 Bacteria 171072
25 Ga0068855_100033231 3300005563 Bacteria 6158
26 Ga0070664_100001338 3300005564 Bacteria 19647
27 Ga0068857_100735855 3300005577 Bacteria 939
28 Ga0068854_100018748 3300005578 Bacteria 4651
29 Ga0068854_100555775 3300005578 Bacteria 974
30 Ga0068856_100023829 3300005614 Bacteria 5954
31 Ga0068852_100111315 3300005616 Bacteria 2490
32 Ga0068851_10160506 3300005834 Unclassified 1235
33 Ga0068851_10213244 3300005834 Bacteria 1082
34 Ga0068870_10064766 3300005840 Bacteria 1975
35 Ga0068860_100000052 3300005843 Bacteria 207351
36 Ga0068862_100367243 3300005844 Bacteria 1339
37 Ga0068862_101531870 3300005844 Bacteria 673
38 Ga0081540_1006614 3300005983 Bacteria 8406
39 Ga0105240_10000731 3300009093 Bacteria 60044
40 Ga0105240_10004400 3300009093 Bacteria 21486
41 Ga0105240_10058159 3300009093 Bacteria 4827
42 Ga0105240_10380977 3300009093 Bacteria 1593
43 Ga0105240_11742194 3300009093 Unclassified 650
44 Ga0114129_10000608 3300009147 Bacteria 44314
45 Ga0105237_10000474 3300009545 Bacteria 57006
46 Ga0105237_10764845 3300009545 Unclassified 973
47 Ga0105249_11282819 3300009553 Unclassified 804
48 Ga0105239_10000935 3300010375 Bacteria 41237
49 Ga0105239_10009693 3300010375 Bacteria 10829
50 Ga0105239_10305992 3300010375 Bacteria 1790
51 Ga0157373_10349880 3300013100 Unclassified 1054
52 Ga0157371_10008695 3300013102 Bacteria 8063
53 Ga0157371_10141332 3300013102 Unclassified 1714
54 Ga0157370_10051775 3300013104 Bacteria 3921
55 Ga0157370_10780115 3300013104 Unclassified 870
56 Ga0157370_11382859 3300013104 Unclassified 634
57 Ga0157369_10168147 3300013105 Bacteria 2311
58 Ga0157374_10324739 3300013296 Bacteria 1526
59 Ga0163162_10011544 3300013306 Bacteria 8617
60 Ga0157372_10114321 3300013307 Bacteria 3094
61 Ga0157372_10125627 3300013307 Bacteria 2949
62 Ga0157372_10125866 3300013307 Bacteria 2946
63 Ga0157372_10247720 3300013307 Bacteria 2068
64 Ga0157372_10275859 3300013307 Bacteria 1954
65 Ga0157375_10970284 3300013308 Bacteria 991
66 Ga0157375_12837167 3300013308 Bacteria 579
67 Ga0163163_10184428 3300014325 Bacteria 2134
68 Ga0209646_1001048 3300025246 Bacteria 8338
69 Ga0207643_10072767 3300025908 Bacteria 1980
70 Ga0207643_10414984 3300025908 Unclassified 853
71 Ga0207695_10000894 3300025913 Bacteria 54057
72 Ga0207695_10016381 3300025913 Bacteria 8673
73 Ga0207695_10019165 3300025913 Bacteria 7883
74 Ga0207695_10255150 3300025913 Bacteria 1653
75 Ga0207671_10303533 3300025914 Bacteria 1261
76 Ga0207649_10562771 3300025920 Bacteria 873
77 Ga0207650_10001776 3300025925 Bacteria 15251
78 Ga0207650_10057095 3300025925 Bacteria 2903
79 Ga0207650_10310617 3300025925 Unclassified 1289
80 Ga0207650_10684203 3300025925 Bacteria 866
81 Ga0207659_10246210 3300025926 Bacteria 1448
82 Ga0207700_10356329 3300025928 Bacteria 1275
83 Ga0207661_10015984 3300025944 Bacteria 5531
84 Ga0207679_10002952 3300025945 Bacteria 10540
85 Ga0207667_10006983 3300025949 Bacteria 13644
86 Ga0207712_10850538 3300025961 Bacteria 804
87 Ga0207640_10155806 3300025981 Bacteria 1684
88 Ga0207640_10751261 3300025981 Bacteria 841
89 Ga0207640_10880075 3300025981 Bacteria 781
90 Ga0207708_10309661 3300026075 Bacteria 1286
91 Ga0207648_10790904 3300026089 Unclassified 883
92 Ga0207683_11544947 3300026121 Unclassified 613
93 Ga0207698_10361574 3300026142 Bacteria 1375
94 Ga0268266_10000057 3300028379 Bacteria 284777
95 Ga0268265_10441080 3300028380 Bacteria 1214
96 Ga0268265_11159401 3300028380 Bacteria 769
97 Ga0268264_10000143 3300028381 Bacteria 170031
98 Ga0307517_10188603 3300028786 Bacteria 1314
99 Ga0307517_10256466 3300028786 Bacteria 1020
100 Ga0307509_10093007 3300031507 Bacteria 3080
101 Ga0307414_10179426 3300032004 Bacteria 1702
102 Ga0307414_10279208 3300032004 Unclassified 1403
103 Ga0395905_0398966 3300037471 Bacteria 1270
104 Ga0395905_0605047 3300037471 Bacteria 998
105 Ga0436363_0420249 3300039450 Bacteria 685
106 Ga0436363_0558648 3300039450 Bacteria 1268
107 Ga0451853_2577915 3300041512 Bacteria 2559
108 Ga0439457_044884 3300042014 Bacteria 987
109 Ga0466972_0000143 3300044658 Bacteria 58694
110 Ga0466960_0245106 3300044901 Bacteria 994
111 Ga0451576_0100935 3300045051 Bacteria 3001
112 Ga0495638_0082997 3300046460 Unclassified 1942
113 Ga0495648_0005636 3300046524 Bacteria 10364
114 Ga0495611_0000081 3300046648 Bacteria 67738
115 Ga0495611_0446883 3300046648 Unclassified 589
116 Ga0495625_0349578 3300046660 Bacteria 935
117 Ga0495649_0142376 3300046694 Bacteria 1262
118 Ga0495687_000111 3300047443 Bacteria 124789
119 Ga0495681_0232562 3300047470 Bacteria 735
120 Ga0501038_0461279 3300049574 Bacteria 976
121 Ga0501047_0030139 3300049581 Bacteria 5231
122 Ga0501048_0769355 3300049582 Bacteria 692
123 Ga0501235_137145 3300049669 Bacteria 624
124 Ga0501266_017107 3300049763 Bacteria 968
125 Ga0501044_0014681 3300049823 Bacteria 8445
126 nmdc:mga05p37_3495_c2 3300050507 Bacteria 11743
127 Ga0500643_042839 3300053087 Unclassified 1322
128 Ga0500646_0002107 3300053090 Bacteria 5188
129 Ga0500646_0019835 3300053090 Bacteria 1782
130 Ga0500646_0096091 3300053090 Bacteria 924
131 Ga0500583_0002476 3300053092 Bacteria 5556
132 Ga0500583_0019356 3300053092 Bacteria 2789
133 Ga0500583_0486549 3300053092 Unclassified 581
134 Ga0500642_0005888 3300053130 Bacteria 3996
135 Ga0500568_0032897 3300053139 Bacteria 2130
136 Ga0500589_005936 3300053147 Bacteria 4821
137 Ga0500604_0047929 3300053151 Bacteria 1311
138 Ga0500622_0000445 3300053156 Bacteria 39381
139 Ga0500637_0491643 3300053178 Bacteria 611
140 Ga0500587_021700 3300053739 Bacteria 842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100847711 Ga0070670_1008477112 142
2 3300005577 Ga0068857_100735855 Ga0068857_1007358552 142
3 3300025925 Ga0207650_10684203 Ga0207650_106842032 142
4 3300026121 Ga0207683_11544947 Ga0207683_115449471 147
5 3300003323 rootH1_10073862 rootH1_100738624 149
6 3300025920 Ga0207649_10562771 Ga0207649_105627712 151
7 3300025928 Ga0207700_10356329 Ga0207700_103563293 151
8 3300005288 Ga0065714_10079897 Ga0065714_100798971 152
9 3300026142 Ga0207698_10361574 Ga0207698_103615742 152
10 3300046694 Ga0495649_0142376 Ga0495649_0142376_215_673 152
11 3300053151 Ga0500604_0047929 Ga0500604_0047929_339_797 152
12 3300005290 Ga0065712_10094549 Ga0065712_100945492 153
13 3300005331 Ga0070670_100055315 Ga0070670_1000553151 153
14 3300005333 Ga0070677_10245317 Ga0070677_102453172 153
15 3300005354 Ga0070675_100402355 Ga0070675_1004023552 153
16 3300025925 Ga0207650_10001776 Ga0207650_100017766 153
17 3300025981 Ga0207640_10880075 Ga0207640_108800751 153
18 3300032004 Ga0307414_10279208 Ga0307414_102792081 153
19 3300042014 Ga0439457_044884 Ga0439457_044884_11_484 153
20 3300047470 Ga0495681_0232562 Ga0495681_0232562_44_505 153
21 3300053090 Ga0500646_0096091 Ga0500646_0096091_423_908 153
22 3300053092 Ga0500583_0486549 Ga0500583_0486549_83_568 153
23 3300013307 Ga0157372_10114321 Ga0157372_101143214 154
24 3300031507 Ga0307509_10093007 Ga0307509_100930073 154
25 3300044658 Ga0466972_0000143 Ga0466972_0000143_44903_45367 154
26 3300003323 rootH1_10094731 rootH1_100947312 155
27 3300005290 Ga0065712_10308989 Ga0065712_103089892 155
28 3300005535 Ga0070684_100026999 Ga0070684_1000269991 155
29 3300005564 Ga0070664_100001338 Ga0070664_10000133822 155
30 3300013104 Ga0157370_11382859 Ga0157370_113828591 155
31 3300025925 Ga0207650_10310617 Ga0207650_103106172 155
32 3300025945 Ga0207679_10002952 Ga0207679_100029522 155
33 3300005356 Ga0070674_101164430 Ga0070674_1011644301 156
34 3300005367 Ga0070667_100454931 Ga0070667_1004549311 156
35 3300005455 Ga0070663_100255992 Ga0070663_1002559922 156
36 3300005834 Ga0068851_10213244 Ga0068851_102132443 156
37 3300009147 Ga0114129_10000608 Ga0114129_1000060843 156
38 3300013308 Ga0157375_10970284 Ga0157375_109702842 156
39 3300025913 Ga0207695_10016381 Ga0207695_100163818 156
40 3300025914 Ga0207671_10303533 Ga0207671_103035331 156
41 3300037471 Ga0395905_0605047 Ga0395905_0605047_376_846 156
42 3300050507 nmdc:mga05p37_3495_c2 nmdc:mga05p37_3495_c2_4620_5090 156
43 3300053092 Ga0500583_0002476 Ga0500583_0002476_4197_4679 156
44 3300053147 Ga0500589_005936 Ga0500589_005936_3483_3965 156
45 3300003320 rootH2_10341030 rootH2_103410301 157
46 3300005329 Ga0070683_100010084 Ga0070683_1000100842 157
47 3300005331 Ga0070670_100240753 Ga0070670_1002407532 157
48 3300005335 Ga0070666_10269541 Ga0070666_102695412 157
49 3300005335 Ga0070666_10842509 Ga0070666_108425091 157
50 3300005344 Ga0070661_100730842 Ga0070661_1007308422 157
51 3300005355 Ga0070671_101424530 Ga0070671_1014245301 157
52 3300005365 Ga0070688_100358778 Ga0070688_1003587781 157
53 3300005535 Ga0070684_100028065 Ga0070684_1000280653 157
54 3300005539 Ga0068853_100089153 Ga0068853_1000891532 157
55 3300005548 Ga0070665_100000094 Ga0070665_100000094118 157
56 3300005563 Ga0068855_100033231 Ga0068855_1000332312 157
57 3300005578 Ga0068854_100018748 Ga0068854_1000187485 157
58 3300005578 Ga0068854_100555775 Ga0068854_1005557751 157
59 3300005614 Ga0068856_100023829 Ga0068856_1000238295 157
60 3300005616 Ga0068852_100111315 Ga0068852_1001113152 157
61 3300005834 Ga0068851_10160506 Ga0068851_101605062 157
62 3300005840 Ga0068870_10064766 Ga0068870_100647662 157
63 3300005843 Ga0068860_100000052 Ga0068860_100000052120 157
64 3300005844 Ga0068862_100367243 Ga0068862_1003672432 157
65 3300005844 Ga0068862_101531870 Ga0068862_1015318702 157
66 3300005983 Ga0081540_1006614 Ga0081540_10066143 157
67 3300009093 Ga0105240_10000731 Ga0105240_1000073121 157
68 3300009093 Ga0105240_10004400 Ga0105240_100044009 157
69 3300009093 Ga0105240_10058159 Ga0105240_100581595 157
70 3300009093 Ga0105240_10380977 Ga0105240_103809772 157
71 3300009093 Ga0105240_11742194 Ga0105240_117421942 157
72 3300009545 Ga0105237_10000474 Ga0105237_1000047420 157
73 3300009545 Ga0105237_10764845 Ga0105237_107648452 157
74 3300009553 Ga0105249_11282819 Ga0105249_112828191 157
75 3300010375 Ga0105239_10000935 Ga0105239_1000093526 157
76 3300010375 Ga0105239_10009693 Ga0105239_100096939 157
77 3300010375 Ga0105239_10305992 Ga0105239_103059923 157
78 3300013100 Ga0157373_10349880 Ga0157373_103498801 157
79 3300013102 Ga0157371_10008695 Ga0157371_100086955 157
80 3300013102 Ga0157371_10141332 Ga0157371_101413322 157
81 3300013104 Ga0157370_10051775 Ga0157370_100517753 157
82 3300013104 Ga0157370_10780115 Ga0157370_107801151 157
83 3300013105 Ga0157369_10168147 Ga0157369_101681473 157
84 3300013296 Ga0157374_10324739 Ga0157374_103247393 157
85 3300013306 Ga0163162_10011544 Ga0163162_1001154410 157
86 3300013307 Ga0157372_10125627 Ga0157372_101256271 157
87 3300013307 Ga0157372_10125866 Ga0157372_101258663 157
88 3300013307 Ga0157372_10247720 Ga0157372_102477202 157
89 3300013307 Ga0157372_10275859 Ga0157372_102758592 157
90 3300013308 Ga0157375_12837167 Ga0157375_128371671 157
91 3300014325 Ga0163163_10184428 Ga0163163_101844282 157
92 3300025246 Ga0209646_1001048 Ga0209646_10010483 157
93 3300025908 Ga0207643_10072767 Ga0207643_100727672 157
94 3300025908 Ga0207643_10414984 Ga0207643_104149842 157
95 3300025913 Ga0207695_10000894 Ga0207695_1000089416 157
96 3300025913 Ga0207695_10019165 Ga0207695_100191659 157
97 3300025913 Ga0207695_10255150 Ga0207695_102551502 157
98 3300025925 Ga0207650_10057095 Ga0207650_100570952 157
99 3300025926 Ga0207659_10246210 Ga0207659_102462102 157
100 3300025944 Ga0207661_10015984 Ga0207661_100159847 157
101 3300025949 Ga0207667_10006983 Ga0207667_1000698310 157
102 3300025961 Ga0207712_10850538 Ga0207712_108505382 157
103 3300025981 Ga0207640_10155806 Ga0207640_101558062 157
104 3300025981 Ga0207640_10751261 Ga0207640_107512611 157
105 3300026075 Ga0207708_10309661 Ga0207708_103096612 157
106 3300026089 Ga0207648_10790904 Ga0207648_107909042 157
107 3300028379 Ga0268266_10000057 Ga0268266_1000005735 157
108 3300028380 Ga0268265_10441080 Ga0268265_104410803 157
109 3300028380 Ga0268265_11159401 Ga0268265_111594011 157
110 3300028381 Ga0268264_10000143 Ga0268264_1000014357 157
111 3300028786 Ga0307517_10188603 Ga0307517_101886032 157
112 3300028786 Ga0307517_10256466 Ga0307517_102564662 157
113 3300032004 Ga0307414_10179426 Ga0307414_101794262 157
114 3300037471 Ga0395905_0398966 Ga0395905_0398966_13_486 157
115 3300039450 Ga0436363_0420249 Ga0436363_0420249_54_533 157
116 3300039450 Ga0436363_0558648 Ga0436363_0558648_660_1133 157
117 3300041512 Ga0451853_2577915 Ga0451853_2577915_1466_1951 157
118 3300044901 Ga0466960_0245106 Ga0466960_0245106_479_958 157
119 3300045051 Ga0451576_0100935 Ga0451576_0100935_670_1158 157
120 3300046460 Ga0495638_0082997 Ga0495638_0082997_217_729 157
121 3300046524 Ga0495648_0005636 Ga0495648_0005636_3773_4285 157
122 3300046648 Ga0495611_0000081 Ga0495611_0000081_63962_64528 157
123 3300046648 Ga0495611_0446883 Ga0495611_0446883_20_532 157
124 3300046660 Ga0495625_0349578 Ga0495625_0349578_378_890 157
125 3300047443 Ga0495687_000111 Ga0495687_000111_27265_27765 157
126 3300049574 Ga0501038_0461279 Ga0501038_0461279_437_910 157
127 3300049581 Ga0501047_0030139 Ga0501047_0030139_2729_3214 157
128 3300049582 Ga0501048_0769355 Ga0501048_0769355_16_489 157
129 3300049669 Ga0501235_137145 Ga0501235_137145_43_519 157
130 3300049763 Ga0501266_017107 Ga0501266_017107_425_901 157
131 3300049823 Ga0501044_0014681 Ga0501044_0014681_4689_5162 157
132 3300053087 Ga0500643_042839 Ga0500643_042839_737_1249 157
133 3300053090 Ga0500646_0002107 Ga0500646_0002107_553_1038 157
134 3300053090 Ga0500646_0019835 Ga0500646_0019835_700_1173 157
135 3300053092 Ga0500583_0019356 Ga0500583_0019356_1270_1743 157
136 3300053130 Ga0500642_0005888 Ga0500642_0005888_935_1447 157
137 3300053139 Ga0500568_0032897 Ga0500568_0032897_1050_1562 157
138 3300053156 Ga0500622_0000445 Ga0500622_0000445_24263_24775 157
139 3300053178 Ga0500637_0491643 Ga0500637_0491643_91_564 157
140 3300053739 Ga0500587_021700 Ga0500587_021700_112_597 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

20

122

0.95

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

127

183

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lrq-assembly2.cif.gz_D crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395 0.9377 2 148
2cwd-assembly3.cif.gz_C crystal structure of tt1001 protein from thermus thermophilus hb8 0.9371 1 149
7dhe-assembly4.cif.gz_D vibrio vulnificus wzb in complex with benzylphosphonate 0.9341 2 149
2wja-assembly1.cif.gz_A crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with phosphate. 0.9336 2 144
4kk4-assembly1.cif.gz_A ywle arginine phosphatase - c7s mutant with phosphorylated active site serine 0.9327 1 154
ID Description Score Start End Superfamily
2cwdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9371 1 149 3.40.50.2300
af_Q2FWE3_1_138_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9257 1 149 3.40.50.2300
2wjaB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9241 2 150 3.40.50.2300
4kk3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9232 3 155 3.40.50.2300
5gotA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9226 2 150 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4R2WFW4-F1-model_v4 deleted 1 1 150
AF-A0A6M1Q2M2-F1-model_v4 deleted 0.9998 1 85
AF-A0A4Q5UY06-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9989 5 140 GO:0004725
AF-A0A537K6M5-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.9975 5 149 GO:0004725
AF-A0A317IUI1-F1-model_v4 protein-tyrosine-phosphatase (EC 3.1.3.48) 0.997 5 125 GO:0004725

Feature Viewer

pLDDT pTM Quality
95.17 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map