F177959

General Info

Members Datasets Scaffolds Average Seq Length
139 112 66 205

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2904113452|2904118291
Length 221
Sequence GIDQASSSWKKRWVVGITGASGSVYGIRLIETLLQMDYLVHLVITEAGWRVLKEELGWETSRRSAAIEQRFGEAMAANKLVFHPNADIGASIASGSYRVHGMVIVPCSMGTLASISHGISDDLMTRAADVMIKENRKLLIVPRETPLHAIHLENMLTLARLGVRMIPAMPAFYYKPQSMDEMIDFLVGKILDNMEIEHDLYRRWGDEQNGHKESPDHHRKN

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
4 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
5 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
6 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
7 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
8 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
9 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
10 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
11 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
12 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
13 2671180694 Paenibacillus sp. A3 Isolate Unclassified
14 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
15 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
16 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
17 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
18 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
19 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
20 2818991459 Paenibacillus sp. 597 Isolate Unclassified
21 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
22 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
23 2857472729 Cohnella sp. R-74144 Isolate Unclassified
24 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
25 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
26 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
27 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
28 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
29 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
30 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
31 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
32 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
33 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
34 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
35 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
36 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
37 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
38 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
39 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
40 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
41 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
42 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
43 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
44 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
45 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
46 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
47 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
48 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
49 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
50 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
51 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
52 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
53 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
54 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
55 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
56 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
57 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
58 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
59 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
60 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
61 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
62 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
63 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
64 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
65 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
88 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
89 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
90 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
102 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
103 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
105 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
106 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
107 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
108 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
109 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
110 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
111 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
112 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 46.76
Metatranscriptomes 0.72
Isolates 52.52

Biome Distribution

Category Percentage (%)
Aerial Root 1.44
Bulb 0
Endosphere 10.07
Nodule 0.72
Rhizoplane 0
Rhizosphere 43.88
Stem 0
Stem Tuber 0
Unclassified 43.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000103 3300003751 Bacteria 67925
2 Ga0055535_1002370 3300003761 Bacteria 6750
3 Ga0055541_1000137 3300003841 Bacteria 40035
4 Ga0105244_10005982 3300009036 Bacteria 7969
5 Ga0105244_10068835 3300009036 Bacteria 1768
6 Ga0157371_10078603 3300013102 Bacteria 2337
7 Ga0157371_10220238 3300013102 Bacteria 1363
8 Ga0209784_100046 3300025224 Bacteria 200009
9 Ga0209566_100015 3300025225 Bacteria 457963
10 Ga0209566_100090 3300025225 Bacteria 141829
11 Ga0209566_100711 3300025225 Bacteria 19035
12 Ga0209566_103368 3300025225 Bacteria 2484
13 Ga0209437_101024 3300025233 Bacteria 9545
14 Ga0209258_100976 3300025242 Bacteria 13354
15 Ga0209675_1009085 3300025291 Bacteria 3553
16 Ga0209025_1026668 3300025294 Bacteria 2891
17 Ga0209025_1030324 3300025294 Bacteria 2591
18 Ga0209025_1030329 3300025294 Bacteria 2591
19 Ga0207655_1022237 3300025728 Bacteria 3187
20 Ga0400489_94888 3300039093 Unclassified 1345
21 Ga0436365_0193860 3300039437 Unclassified 2738
22 Ga0439436_0010778 3300041404 Bacteria 2785
23 Ga0439439_0005644 3300041406 Bacteria 2866
24 Ga0439439_0050904 3300041406 Bacteria 1086
25 Ga0439457_011409 3300042014 Unclassified 2022
26 Ga0439462_0036165 3300042015 Bacteria 1314
27 Ga0466969_0003101 3300044656 Bacteria 8857
28 Ga0466966_0084381 3300044684 Bacteria 1976
29 Ga0466961_0063322 3300044693 Bacteria 2350
30 Ga0466967_0289630 3300045976 Bacteria 1573
31 Ga0495660_0012037 3300046810 Bacteria 5018
32 Ga0495636_0368423 3300047318 Bacteria 680
33 Ga0495681_0103899 3300047470 Bacteria 1238
34 Ga0496116_0004021 3300048919 Bacteria 14259
35 Ga0496116_0006314 3300048919 Bacteria 10785
36 Ga0496116_0012911 3300048919 Bacteria 6780
37 Ga0496116_0024178 3300048919 Bacteria 4499
38 Ga0496116_0055292 3300048919 Bacteria 2608
39 Ga0496116_0216983 3300048919 Bacteria 985
40 Ga0496117_0004206 3300048920 Bacteria 16068
41 Ga0496118_0077395 3300048921 Bacteria 2359
42 Ga0496119_0004974 3300048922 Bacteria 12981
43 Ga0496120_0004419 3300048923 Bacteria 11799
44 Ga0496120_0173840 3300048923 Bacteria 1063
45 Ga0496121_0079289 3300048924 Bacteria 2607
46 Ga0496121_0103648 3300048924 Bacteria 2188
47 Ga0496121_0118675 3300048924 Bacteria 2002
48 Ga0496121_0370401 3300048924 Bacteria 948
49 Ga0496122_0028569 3300048925 Bacteria 4727
50 Ga0496122_0037304 3300048925 Bacteria 3914
51 Ga0496122_0039842 3300048925 Bacteria 3741
52 Ga0496122_0045856 3300048925 Bacteria 3392
53 Ga0496122_0075278 3300048925 Bacteria 2383
54 Ga0496122_0135508 3300048925 Bacteria 1553
55 Ga0496122_0198868 3300048925 Bacteria 1174
56 Ga0496123_0007304 3300048926 Bacteria 10478
57 Ga0496124_0000657 3300048927 Bacteria 57039
58 Ga0496124_0119973 3300048927 Bacteria 2103
59 Ga0496125_0002232 3300048928 Bacteria 25769
60 Ga0496125_0006411 3300048928 Bacteria 12722
61 Ga0496125_0006861 3300048928 Bacteria 12208
62 Ga0496125_0066932 3300048928 Bacteria 2835
63 Ga0496126_0089602 3300048929 Bacteria 2707
64 Ga0501208_062754 3300049655 Bacteria 732
65 Ga0501217_000737 3300049661 Bacteria 5654
66 Ga0587067_044194 3300059640 Bacteria 877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0368423 Ga0495636_0368423_74_613 172
2 3300039093 Ga0400489_94888 Ga0400489_94888_563_1117 183
3 3300003761 Ga0055535_1002370 Ga0055535_10023706 186
4 3300003841 Ga0055541_1000137 Ga0055541_100013740 186
5 3300025225 Ga0209566_100015 Ga0209566_100015177 186
6 3300025242 Ga0209258_100976 Ga0209258_10097612 186
7 3300025294 Ga0209025_1030324 Ga0209025_10303242 186
8 3300025294 Ga0209025_1030329 Ga0209025_10303292 186
9 iso_pu_bacteria 2980182181 2980189712 186
10 3300025294 Ga0209025_1026668 Ga0209025_10266682 187
11 3300045976 Ga0466967_0289630 Ga0466967_0289630_779_1444 188
12 3300025291 Ga0209675_1009085 Ga0209675_10090853 189
13 3300049655 Ga0501208_062754 Ga0501208_062754_51_668 191
14 iso_pu_bacteria 8055632911 8055635617 191
15 iso_pu_bacteria 2512564039 2512732532 192
16 iso_pu_bacteria 2585428059 2587738717 192
17 iso_pu_bacteria 2593339198 2595315553 192
18 iso_pu_bacteria 2643221676 2644421707 192
19 iso_pu_bacteria 2671180694 2673823341 192
20 iso_pu_bacteria 2889295896 2889297170 192
21 iso_pu_bacteria 2980125574 2980126901 192
22 iso_pu_bacteria 2981284811 2981285649 192
23 iso_pu_bacteria 2981289755 2981290596 192
24 iso_pu_bacteria 2981980479 2981980781 192
25 iso_pu_bacteria 2981985349 2981985659 192
26 iso_pu_bacteria 8054795415 8054798207 192
27 3300025225 Ga0209566_100711 Ga0209566_10071113 193
28 3300059640 Ga0587067_044194 Ga0587067_044194_127_738 193
29 iso_pu_bacteria 2818991459 2819669225 193
30 iso_pu_bacteria 2857453340 2857453805 193
31 iso_pu_bacteria 2904755435 2904762077 193
32 iso_pu_bacteria 2919425241 2919431556 193
33 iso_pu_bacteria 2929206907 2929208711 193
34 iso_pu_bacteria 2971410472 2971417090 193
35 iso_pu_bacteria 8056533031 8056536498 193
36 3300039437 Ga0436365_0193860 Ga0436365_0193860_240_872 195
37 iso_pu_bacteria 2548877040 2550900777 196
38 iso_pu_bacteria 2571042588 2573039517 196
39 iso_pu_bacteria 2576861424 2578337710 196
40 iso_pu_bacteria 2579778775 2580930045 196
41 iso_pu_bacteria 2619619294 2621276049 196
42 iso_pu_bacteria 2643221543 2643738366 196
43 iso_pu_bacteria 2728368933 2728529570 196
44 iso_pu_bacteria 2821111986 2821114327 196
45 iso_pu_bacteria 2864733723 2864737423 196
46 iso_pu_bacteria 2865002811 2865003690 196
47 iso_pu_bacteria 2881636855 2881636944 196
48 iso_pu_bacteria 2885526491 2885527783 196
49 iso_pu_bacteria 2889276214 2889280536 196
50 iso_pu_bacteria 2904162308 2904163576 196
51 iso_pu_bacteria 2938649242 2938651819 196
52 iso_pu_bacteria 2939679117 2939680730 196
53 iso_pu_bacteria 2968558590 2968562851 196
54 iso_pu_bacteria 2971403814 2971407830 196
55 iso_pu_bacteria 2971511577 2971512311 196
56 iso_pu_bacteria 2980176882 2980177407 196
57 iso_pu_bacteria 2988225383 2988231982 196
58 iso_pu_bacteria 2996632988 2996638175 196
59 iso_pu_bacteria 8054465665 8054469566 196
60 iso_pu_bacteria 8057733483 8057739504 196
61 3300044656 Ga0466969_0003101 Ga0466969_0003101_7708_8307 197
62 3300044684 Ga0466966_0084381 Ga0466966_0084381_212_811 197
63 3300044693 Ga0466961_0063322 Ga0466961_0063322_221_820 197
64 iso_pu_bacteria 2889042446 2889046433 197
65 iso_pu_bacteria 2904490793 2904493336 197
66 iso_pu_bacteria 2919160200 2919162628 197
67 iso_pu_bacteria 2925326138 2925331733 197
68 iso_pu_bacteria 2931384279 2931389882 197
69 iso_pu_bacteria 2945991243 2945991426 197
70 iso_pu_bacteria 2946053406 2946054122 197
71 iso_pu_bacteria 8002317523 8002323765 197
72 iso_pu_bacteria 2563366752 2563928987 198
73 iso_pu_bacteria 2907202186 2907205219 198
74 iso_pu_bacteria 8046991243 8046998775 198
75 3300048925 Ga0496122_0198868 Ga0496122_0198868_426_1064 199
76 3300003751 Ga0055538_1000103 Ga0055538_10001033 200
77 3300009036 Ga0105244_10005982 Ga0105244_100059828 200
78 3300009036 Ga0105244_10068835 Ga0105244_100688352 200
79 3300013102 Ga0157371_10078603 Ga0157371_100786032 200
80 3300013102 Ga0157371_10220238 Ga0157371_102202382 200
81 3300025224 Ga0209784_100046 Ga0209784_1000464 200
82 3300025225 Ga0209566_100090 Ga0209566_100090107 200
83 3300025225 Ga0209566_103368 Ga0209566_1033683 200
84 3300025233 Ga0209437_101024 Ga0209437_10102411 200
85 3300025728 Ga0207655_1022237 Ga0207655_10222375 200
86 3300041404 Ga0439436_0010778 Ga0439436_0010778_1810_2436 200
87 3300041406 Ga0439439_0005644 Ga0439439_0005644_2188_2814 200
88 3300041406 Ga0439439_0050904 Ga0439439_0050904_115_777 200
89 3300042014 Ga0439457_011409 Ga0439457_011409_37_663 200
90 3300042015 Ga0439462_0036165 Ga0439462_0036165_120_782 200
91 3300046810 Ga0495660_0012037 Ga0495660_0012037_3720_4322 200
92 3300047470 Ga0495681_0103899 Ga0495681_0103899_396_998 200
93 3300048919 Ga0496116_0004021 Ga0496116_0004021_6190_6810 200
94 3300048919 Ga0496116_0006314 Ga0496116_0006314_339_1001 200
95 3300048919 Ga0496116_0012911 Ga0496116_0012911_578_1237 200
96 3300048919 Ga0496116_0024178 Ga0496116_0024178_2996_3637 200
97 3300048919 Ga0496116_0055292 Ga0496116_0055292_130_747 200
98 3300048919 Ga0496116_0216983 Ga0496116_0216983_23_664 200
99 3300048920 Ga0496117_0004206 Ga0496117_0004206_7822_8481 200
100 3300048921 Ga0496118_0077395 Ga0496118_0077395_508_1167 200
101 3300048922 Ga0496119_0004974 Ga0496119_0004974_10010_10669 200
102 3300048923 Ga0496120_0004419 Ga0496120_0004419_2479_3138 200
103 3300048923 Ga0496120_0173840 Ga0496120_0173840_376_1035 200
104 3300048924 Ga0496121_0079289 Ga0496121_0079289_1038_1697 200
105 3300048924 Ga0496121_0103648 Ga0496121_0103648_563_1183 200
106 3300048924 Ga0496121_0118675 Ga0496121_0118675_334_963 200
107 3300048924 Ga0496121_0370401 Ga0496121_0370401_11_613 200
108 3300048925 Ga0496122_0028569 Ga0496122_0028569_2872_3489 200
109 3300048925 Ga0496122_0037304 Ga0496122_0037304_3096_3758 200
110 3300048925 Ga0496122_0039842 Ga0496122_0039842_1716_2375 200
111 3300048925 Ga0496122_0045856 Ga0496122_0045856_128_745 200
112 3300048925 Ga0496122_0075278 Ga0496122_0075278_1589_2230 200
113 3300048925 Ga0496122_0135508 Ga0496122_0135508_509_1150 200
114 3300048926 Ga0496123_0007304 Ga0496123_0007304_5638_6300 200
115 3300048927 Ga0496124_0000657 Ga0496124_0000657_42898_43560 200
116 3300048927 Ga0496124_0119973 Ga0496124_0119973_428_1048 200
117 3300048928 Ga0496125_0002232 Ga0496125_0002232_16821_17483 200
118 3300048928 Ga0496125_0006411 Ga0496125_0006411_1121_1738 200
119 3300048928 Ga0496125_0006861 Ga0496125_0006861_588_1247 200
120 3300048928 Ga0496125_0066932 Ga0496125_0066932_887_1516 200
121 3300048929 Ga0496126_0089602 Ga0496126_0089602_1677_2336 200
122 3300049661 Ga0501217_000737 Ga0501217_000737_3726_4370 200
123 iso_pu_bacteria 2524023129 2524186209 200
124 iso_pu_bacteria 2721755693 2723604630 200
125 iso_pu_bacteria 2728369359 2730135270 200
126 iso_pu_bacteria 2751185905 2753809921 200
127 iso_pu_bacteria 2791355222 2793184488 200
128 iso_pu_bacteria 2802428803 2802436891 200
129 iso_pu_bacteria 2857472729 2857473982 200
130 iso_pu_bacteria 2888578766 2888581170 200
131 iso_pu_bacteria 2889049205 2889050151 200
132 iso_pu_bacteria 2904113452 2904118291 200
133 iso_pu_bacteria 2904595352 2904595531 200
134 iso_pu_bacteria 2939702853 2939705284 200
135 iso_pu_bacteria 2984527788 2984530066 200
136 iso_pu_bacteria 2984532647 2984536172 200
137 iso_pu_bacteria 2996706504 2996709077 200
138 iso_pu_bacteria 648028048 648170673 200
139 iso_pu_bacteria 8057977335 8057978889 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

11

194

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejb-assembly1.cif.gz_A crystal structure of phenylacrylic acid decarboxylase from aquifex aeolicus 0.9448 7 193
7km2-assembly1.cif.gz_K dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn 0.9416 7 198
7km3-assembly1.cif.gz_A dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.941 7 196
7km3-assembly1.cif.gz_E dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9409 7 196
7km3-assembly1.cif.gz_L dodecameric structure of the chlamydia trachomatis flavin prenyltransferase ubix ortholog ct220 with fmn and dmap 0.9374 7 196
ID Description Score Start End Superfamily
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.952 7 200 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9448 7 193 3.40.50.1950
4zavA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9349 7 200 3.40.50.1950
2ejbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9292 7 193 3.40.50.1950
af_P33751_55_242_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.9275 7 200 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A7W3XRD3-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9843 1 200 GO:0004659
GO:0008694
AF-A0A172TPX1-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9802 14 199 GO:0016831
GO:0106141
AF-A0A7W3XRD3-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9795 1 200 GO:0004659
GO:0008694
AF-A0A1G8BQV9-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9702 6 200 GO:0016831
GO:0106141
AF-A0A3G3K571-F1-model_v4 Flavin prenyltransferase UbiX (EC 2.5.1.129) 0.9686 6 200 GO:0016831
GO:0106141

Feature Viewer

pLDDT pTM Quality
90.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map