F176829

General Info

Members Datasets Scaffolds Average Seq Length
139 101 139 292

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10000572|Ga0265342_1000057230
Length 325
Sequence VSNPRRNSESILWSAGLVTALAICGCSGSVGTGGQTGTGTATGRSAGCGTMPTIPSANYNNGHHIAITVGTMAREYILNVPTNYDNSHPYKFIIAYHELNGNDDEMFRNQYYHLLPLANNTAIFVAPNGQQNNANCTQAGGCGWPNPQNTDLAFADALVAQIEQNFCVDTNRIFATGWSFGGSMSYKTACERPLGGVSNGYIRAIAVYSGSQLSGNCTPTKPVAYYASHGTVDSVLCYDQTRAAGCAVGNGVSLAQNFSMANGCTFMTPTKVTSGNHVCTSMTGCMTGYPVEFCSFNGPHTPDPMDPGQRTSWEYQNVWDFLSQF

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
96 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
100 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 3.6
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10082301 3300003320 Bacteria 5483
2 rootH1_10077100 3300003323 Bacteria 3742
3 Ga0070658_10000373 3300005327 Bacteria 39003
4 Ga0070676_10017437 3300005328 Bacteria 3974
5 Ga0070683_100000460 3300005329 Bacteria 28496
6 Ga0070690_100009065 3300005330 Bacteria 5754
7 Ga0070677_10016574 3300005333 Unclassified 2626
8 Ga0070666_10048396 3300005335 Bacteria 2857
9 Ga0070680_100028093 3300005336 Bacteria 4511
10 Ga0070680_100188478 3300005336 Bacteria 1738
11 Ga0070682_100000882 3300005337 Bacteria 17486
12 Ga0070682_100004035 3300005337 Bacteria 8158
13 Ga0070682_100206122 3300005337 Bacteria 1390
14 Ga0070689_100000015 3300005340 Bacteria 179920
15 Ga0070689_100014753 3300005340 Bacteria 5684
16 Ga0070689_100030517 3300005340 Bacteria 4092
17 Ga0070669_100001743 3300005353 Bacteria 15681
18 Ga0070674_100006388 3300005356 Bacteria 6873
19 Ga0070673_100000061 3300005364 Bacteria 45348
20 Ga0070673_100182404 3300005364 Bacteria 1798
21 Ga0070659_100024245 3300005366 Bacteria 4650
22 Ga0070701_10042868 3300005438 Bacteria 2312
23 Ga0070681_10052761 3300005458 Unclassified 4056
24 Ga0068867_100080991 3300005459 Bacteria 2447
25 Ga0070679_100007217 3300005530 Bacteria 10377
26 Ga0070679_100021200 3300005530 Bacteria 6340
27 Ga0070684_100000932 3300005535 Bacteria 20782
28 Ga0068853_100013427 3300005539 Bacteria 6686
29 Ga0070672_100054090 3300005543 Bacteria 3141
30 Ga0070672_100059463 3300005543 Bacteria 3007
31 Ga0070686_100001680 3300005544 Bacteria 12359
32 Ga0070686_100008055 3300005544 Bacteria 5886
33 Ga0070693_100260058 3300005547 Unclassified 1154
34 Ga0070665_100187694 3300005548 Bacteria 2068
35 Ga0068855_100000254 3300005563 Bacteria 67241
36 Ga0068855_100100737 3300005563 Bacteria 3326
37 Ga0068859_100006493 3300005617 Bacteria 11871
38 Ga0068859_100008149 3300005617 Bacteria 10627
39 Ga0068864_100262850 3300005618 Bacteria 1606
40 Ga0068858_100066093 3300005842 Bacteria 3347
41 Ga0097620_100006493 3300006931 Bacteria 11871
42 Ga0097620_100008149 3300006931 Bacteria 10627
43 Ga0105240_10000794 3300009093 Bacteria 57248
44 Ga0105241_10529473 3300009174 Bacteria 1055
45 Ga0105237_10000069 3300009545 Bacteria 138459
46 Ga0105237_10394032 3300009545 Bacteria 1389
47 Ga0105238_10003513 3300009551 Bacteria 15611
48 Ga0105238_10075398 3300009551 Bacteria 3365
49 Ga0105238_10095515 3300009551 Bacteria 2959
50 Ga0105239_10848473 3300010375 Bacteria 1048
51 Ga0157374_10229165 3300013296 Bacteria 1825
52 Ga0207680_10032531 3300025903 Bacteria 2965
53 Ga0207705_10002336 3300025909 Bacteria 14682
54 Ga0207695_10004950 3300025913 Bacteria 17941
55 Ga0207671_10000154 3300025914 Bacteria 106945
56 Ga0207660_10074935 3300025917 Unclassified 2471
57 Ga0207662_10002664 3300025918 Bacteria 9004
58 Ga0207652_10000542 3300025921 Bacteria 38273
59 Ga0207652_10002740 3300025921 Bacteria 14787
60 Ga0207681_10048395 3300025923 Bacteria 2869
61 Ga0207694_10003090 3300025924 Bacteria 13327
62 Ga0207694_10005371 3300025924 Bacteria 9865
63 Ga0207659_10292960 3300025926 Unclassified 1334
64 Ga0207670_10000008 3300025936 Bacteria 303208
65 Ga0207670_10009816 3300025936 Bacteria 5482
66 Ga0207691_10019798 3300025940 Bacteria 6365
67 Ga0207661_10020560 3300025944 Bacteria 4936
68 Ga0207667_10000214 3300025949 Bacteria 81843
69 Ga0207667_10001145 3300025949 Bacteria 33320
70 Ga0207667_10043602 3300025949 Unclassified 4760
71 Ga0207667_10082380 3300025949 Bacteria 3333
72 Ga0207667_10148670 3300025949 Unclassified 2411
73 Ga0207651_10027748 3300025960 Bacteria 3561
74 Ga0207677_10117606 3300026023 Bacteria 1993
75 Ga0207703_10029343 3300026035 Bacteria 4339
76 Ga0207639_10009838 3300026041 Bacteria 6607
77 Ga0207702_10303277 3300026078 Bacteria 1516
78 Ga0207648_10003548 3300026089 Bacteria 16321
79 Ga0207683_10045216 3300026121 Bacteria 3850
80 Ga0207683_10060084 3300026121 Bacteria 3341
81 Ga0207428_10007896 3300027907 Bacteria 9672
82 Ga0268266_10331030 3300028379 Bacteria 1427
83 Ga0268264_10667145 3300028381 Bacteria 1030
84 Ga0265324_10009596 3300029957 Unclassified 3770
85 Ga0265330_10011537 3300031235 Bacteria 4141
86 Ga0265332_10026421 3300031238 Unclassified 2547
87 Ga0265325_10000511 3300031241 Bacteria 28048
88 Ga0265325_10032024 3300031241 Unclassified 2810
89 Ga0265340_10002733 3300031247 Bacteria 10052
90 Ga0265340_10004733 3300031247 Bacteria 7565
91 Ga0265339_10000087 3300031249 Bacteria 78504
92 Ga0265339_10003380 3300031249 Bacteria 11170
93 Ga0265339_10005635 3300031249 Bacteria 8307
94 Ga0265316_10002298 3300031344 Bacteria 19967
95 Ga0265316_10055230 3300031344 Bacteria 3107
96 Ga0265313_10012158 3300031595 Bacteria 5290
97 Ga0265314_10000002 3300031711 Bacteria 2092193
98 Ga0265314_10000030 3300031711 Bacteria 266231
99 Ga0265342_10000572 3300031712 Bacteria 38915
100 Ga0265342_10000726 3300031712 Bacteria 34005
101 Ga0373957_0044328 3300035120 Bacteria 1683
102 Ga0373955_0009935 3300035172 Unclassified 4479
103 Ga0373955_0334896 3300035172 Unclassified 915
104 Ga0373924_0076301 3300035410 Bacteria 1420
105 Ga0373933_0031221 3300035724 Bacteria 3090
106 Ga0373947_0173868 3300035725 Bacteria 1399
107 Ga0373937_0022144 3300036401 Bacteria 5709
108 Ga0373937_0040676 3300036401 Unclassified 4237
109 Ga0373937_0066224 3300036401 Unclassified 3326
110 Ga0373937_0266572 3300036401 Bacteria 1616
111 Ga0451807_1185306 3300041486 Bacteria 1191
112 Ga0451843_0772657 3300041509 Bacteria 1201
113 Ga0451853_2384834 3300041512 Bacteria 994
114 Ga0466968_0101775 3300044735 Bacteria 1283
115 Ga0466957_0277270 3300044842 Bacteria 1121
116 Ga0495634_0011029 3300046642 Bacteria 6596
117 Ga0495684_0237643 3300047471 Bacteria 1330
118 Ga0496100_0038661 3300048903 Unclassified 3025
119 Ga0496108_0163079 3300048911 Bacteria 1927
120 Ga0496112_0095686 3300048915 Bacteria 2940
121 Ga0496114_0303031 3300048917 Unclassified 1411
122 Ga0501067_0041074 3300049583 Bacteria 2568
123 Ga0501067_0352050 3300049583 Unclassified 821
124 Ga0501068_0079979 3300049584 Viruses 2004
125 Ga0501069_0079177 3300049585 Unclassified 1849
126 Ga0501071_0016813 3300049587 Bacteria 5033
127 Ga0501073_0001926 3300049589 Bacteria 15448
128 Ga0501073_0060203 3300049589 Bacteria 2650
129 Ga0501073_0088128 3300049589 Bacteria 2158
130 Ga0501075_0243980 3300049591 Bacteria 1369
131 Ga0501076_0131079 3300049592 Unclassified 2033
132 Ga0501235_053414 3300049669 Bacteria 939
133 Ga0501225_0039718 3300049705 Bacteria 1297
134 Ga0501081_0421930 3300049743 Bacteria 989
135 nmdc:mga08y16_2910_c1 3300050511 Bacteria 17621
136 Ga0495619_0089556 3300053085 Bacteria 2082
137 Ga0500578_0000241 3300053086 Eukaryota 67855
138 Ga0500578_0074476 3300053086 Eukaryota 2163
139 Ga0501082_0126868 3300060353 Bacteria 2213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0076301 Ga0373924_0076301_632_1378 242
2 3300049583 Ga0501067_0352050 Ga0501067_0352050_25_810 250
3 3300009174 Ga0105241_10529473 Ga0105241_105294731 254
4 3300009551 Ga0105238_10003513 Ga0105238_1000351310 254
5 3300049743 Ga0501081_0421930 Ga0501081_0421930_197_967 254
6 3300009093 Ga0105240_10000794 Ga0105240_1000079434 258
7 3300010375 Ga0105239_10848473 Ga0105239_108484731 258
8 3300025909 Ga0207705_10002336 Ga0207705_100023362 258
9 3300025913 Ga0207695_10004950 Ga0207695_100049505 258
10 3300025921 Ga0207652_10002740 Ga0207652_100027404 258
11 3300005548 Ga0070665_100187694 Ga0070665_1001876942 259
12 3300028379 Ga0268266_10331030 Ga0268266_103310302 259
13 3300005547 Ga0070693_100260058 Ga0070693_1002600581 261
14 3300013296 Ga0157374_10229165 Ga0157374_102291651 262
15 3300049584 Ga0501068_0079979 Ga0501068_0079979_1198_1992 263
16 3300053086 Ga0500578_0074476 Ga0500578_0074476_172_1101 265
17 3300053086 Ga0500578_0000241 Ga0500578_0000241_53776_54621 266
18 3300005617 Ga0068859_100008149 Ga0068859_10000814910 268
19 3300006931 Ga0097620_100008149 Ga0097620_10000814910 268
20 3300009545 Ga0105237_10394032 Ga0105237_103940322 268
21 3300025924 Ga0207694_10005371 Ga0207694_100053715 268
22 3300028381 Ga0268264_10667145 Ga0268264_106671451 268
23 3300041512 Ga0451853_2384834 Ga0451853_2384834_148_966 269
24 3300009551 Ga0105238_10095515 Ga0105238_100955152 270
25 3300035120 Ga0373957_0044328 Ga0373957_0044328_411_1241 270
26 3300041509 Ga0451843_0772657 Ga0451843_0772657_136_948 270
27 3300046642 Ga0495634_0011029 Ga0495634_0011029_2355_3710 270
28 3300047471 Ga0495684_0237643 Ga0495684_0237643_331_1161 270
29 3300005543 Ga0070672_100059463 Ga0070672_1000594632 272
30 3300035172 Ga0373955_0334896 Ga0373955_0334896_15_848 273
31 3300025926 Ga0207659_10292960 Ga0207659_102929601 274
32 3300048915 Ga0496112_0095686 Ga0496112_0095686_2007_2843 274
33 3300005327 Ga0070658_10000373 Ga0070658_1000037315 275
34 3300005336 Ga0070680_100188478 Ga0070680_1001884782 275
35 3300005458 Ga0070681_10052761 Ga0070681_100527613 275
36 3300025917 Ga0207660_10074935 Ga0207660_100749352 275
37 3300005329 Ga0070683_100000460 Ga0070683_10000046024 276
38 3300025944 Ga0207661_10020560 Ga0207661_100205603 276
39 3300031249 Ga0265339_10005635 Ga0265339_100056352 276
40 3300031344 Ga0265316_10002298 Ga0265316_100022989 276
41 3300031711 Ga0265314_10000002 Ga0265314_10000002304 276
42 3300049589 Ga0501073_0088128 Ga0501073_0088128_699_2054 276
43 3300005336 Ga0070680_100028093 Ga0070680_1000280933 277
44 3300005530 Ga0070679_100007217 Ga0070679_1000072175 277
45 3300025921 Ga0207652_10000542 Ga0207652_100005422 277
46 3300049669 Ga0501235_053414 Ga0501235_053414_43_876 277
47 3300049705 Ga0501225_0039718 Ga0501225_0039718_428_1261 277
48 3300005340 Ga0070689_100030517 Ga0070689_1000305172 278
49 3300005535 Ga0070684_100000932 Ga0070684_1000009326 278
50 3300025924 Ga0207694_10003090 Ga0207694_100030906 278
51 3300041486 Ga0451807_1185306 Ga0451807_1185306_320_1156 278
52 3300005617 Ga0068859_100006493 Ga0068859_1000064936 279
53 3300006931 Ga0097620_100006493 Ga0097620_1000064936 279
54 3300009551 Ga0105238_10075398 Ga0105238_100753982 279
55 3300025949 Ga0207667_10148670 Ga0207667_101486701 279
56 3300035725 Ga0373947_0173868 Ga0373947_0173868_180_1259 279
57 3300060353 Ga0501082_0126868 Ga0501082_0126868_40_1074 279
58 3300005340 Ga0070689_100014753 Ga0070689_1000147536 280
59 3300005364 Ga0070673_100000061 Ga0070673_10000006134 280
60 3300025936 Ga0207670_10009816 Ga0207670_100098162 280
61 3300025960 Ga0207651_10027748 Ga0207651_100277482 280
62 3300026121 Ga0207683_10060084 Ga0207683_100600843 280
63 3300044842 Ga0466957_0277270 Ga0466957_0277270_147_1070 280
64 3300005340 Ga0070689_100000015 Ga0070689_10000001567 281
65 3300025936 Ga0207670_10000008 Ga0207670_1000000881 281
66 3300031247 Ga0265340_10004733 Ga0265340_100047335 281
67 3300049587 Ga0501071_0016813 Ga0501071_0016813_1259_2146 281
68 3300049589 Ga0501073_0060203 Ga0501073_0060203_543_1571 281
69 3300049591 Ga0501075_0243980 Ga0501075_0243980_28_915 281
70 3300049592 Ga0501076_0131079 Ga0501076_0131079_653_1540 281
71 3300036401 Ga0373937_0022144 Ga0373937_0022144_1403_2734 282
72 3300053085 Ga0495619_0089556 Ga0495619_0089556_154_1485 282
73 3300044735 Ga0466968_0101775 Ga0466968_0101775_111_1199 284
74 3300005337 Ga0070682_100000882 Ga0070682_10000088211 285
75 3300005337 Ga0070682_100004035 Ga0070682_1000040352 286
76 3300025949 Ga0207667_10043602 Ga0207667_100436023 286
77 3300036401 Ga0373937_0066224 Ga0373937_0066224_1117_2301 286
78 3300048903 Ga0496100_0038661 Ga0496100_0038661_1490_2917 286
79 3300005438 Ga0070701_10042868 Ga0070701_100428682 287
80 3300048911 Ga0496108_0163079 Ga0496108_0163079_382_1803 287
81 3300049583 Ga0501067_0041074 Ga0501067_0041074_776_2212 287
82 3300049589 Ga0501073_0001926 Ga0501073_0001926_4035_5471 287
83 3300005530 Ga0070679_100021200 Ga0070679_1000212002 288
84 3300009545 Ga0105237_10000069 Ga0105237_1000006943 288
85 3300025914 Ga0207671_10000154 Ga0207671_1000015430 288
86 3300026078 Ga0207702_10303277 Ga0207702_103032771 288
87 3300026121 Ga0207683_10045216 Ga0207683_100452164 288
88 3300031235 Ga0265330_10011537 Ga0265330_100115374 288
89 3300031241 Ga0265325_10000511 Ga0265325_100005115 288
90 3300031247 Ga0265340_10002733 Ga0265340_100027334 288
91 3300031344 Ga0265316_10055230 Ga0265316_100552301 288
92 3300031711 Ga0265314_10000030 Ga0265314_10000030119 288
93 3300031712 Ga0265342_10000726 Ga0265342_1000072617 288
94 3300005328 Ga0070676_10017437 Ga0070676_100174372 289
95 3300005335 Ga0070666_10048396 Ga0070666_100483962 289
96 3300005353 Ga0070669_100001743 Ga0070669_1000017437 289
97 3300005356 Ga0070674_100006388 Ga0070674_1000063884 289
98 3300005364 Ga0070673_100182404 Ga0070673_1001824042 289
99 3300005366 Ga0070659_100024245 Ga0070659_1000242455 289
100 3300005459 Ga0068867_100080991 Ga0068867_1000809912 289
101 3300005543 Ga0070672_100054090 Ga0070672_1000540903 289
102 3300005544 Ga0070686_100001680 Ga0070686_1000016808 289
103 3300005842 Ga0068858_100066093 Ga0068858_1000660932 289
104 3300025903 Ga0207680_10032531 Ga0207680_100325312 289
105 3300025923 Ga0207681_10048395 Ga0207681_100483952 289
106 3300025940 Ga0207691_10019798 Ga0207691_100197984 289
107 3300026035 Ga0207703_10029343 Ga0207703_100293432 289
108 3300026089 Ga0207648_10003548 Ga0207648_100035482 289
109 3300031238 Ga0265332_10026421 Ga0265332_100264211 290
110 3300035172 Ga0373955_0009935 Ga0373955_0009935_354_1532 291
111 3300035724 Ga0373933_0031221 Ga0373933_0031221_38_1216 291
112 3300036401 Ga0373937_0040676 Ga0373937_0040676_987_2165 291
113 3300029957 Ga0265324_10009596 Ga0265324_100095963 292
114 3300031241 Ga0265325_10032024 Ga0265325_100320243 292
115 3300031249 Ga0265339_10000087 Ga0265339_100000872 292
116 3300031595 Ga0265313_10012158 Ga0265313_100121585 292
117 3300005337 Ga0070682_100206122 Ga0070682_1002061221 293
118 3300025949 Ga0207667_10001145 Ga0207667_1000114510 293
119 3300005539 Ga0068853_100013427 Ga0068853_1000134273 294
120 3300005563 Ga0068855_100100737 Ga0068855_1001007372 294
121 3300025949 Ga0207667_10082380 Ga0207667_100823802 294
122 3300026041 Ga0207639_10009838 Ga0207639_100098383 294
123 3300031249 Ga0265339_10003380 Ga0265339_100033806 294
124 3300005544 Ga0070686_100008055 Ga0070686_1000080553 295
125 3300026023 Ga0207677_10117606 Ga0207677_101176061 295
126 3300005330 Ga0070690_100009065 Ga0070690_1000090653 296
127 3300031712 Ga0265342_10000572 Ga0265342_1000057230 296
128 3300005618 Ga0068864_100262850 Ga0068864_1002628502 297
129 3300025918 Ga0207662_10002664 Ga0207662_100026644 297
130 3300049585 Ga0501069_0079177 Ga0501069_0079177_206_1402 297
131 3300036401 Ga0373937_0266572 Ga0373937_0266572_82_1308 298
132 3300027907 Ga0207428_10007896 Ga0207428_100078968 300
133 3300048917 Ga0496114_0303031 Ga0496114_0303031_35_1270 300
134 3300050511 nmdc:mga08y16_2910_c1 nmdc:mga08y16_2910_c1_5831_7099 300
135 3300005333 Ga0070677_10016574 Ga0070677_100165743 302
136 3300005563 Ga0068855_100000254 Ga0068855_10000025428 305
137 3300025949 Ga0207667_10000214 Ga0207667_1000021432 305
138 3300003323 rootH1_10077100 rootH1_100771002 306
139 3300003320 rootH2_10082301 rootH2_100823014 315

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8128 69 313
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7848 69 313
7d79-assembly1.cif.gz_D the structure of dcsb complex with its substrate analogue 0.7516 56 210
5xb6-assembly1.cif.gz_B crystal structure of ycjy from e. coli 0.7416 56 209
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.7363 56 254
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8128 69 313 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7848 69 313 3.40.50.1820
af_I6XVY0_18_280_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.766 46 313 3.40.50.1820
af_Q4DRX5_77_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7622 52 312 3.40.50.1820
af_I6XVY0_18_280_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7414 46 313 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A150PUC2-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9918 45 315 GO:0005576
GO:0030600
GO:0045493
AF-A0A150PUC2-F1-model_v4 Phospholipase/carboxylesterase/thioesterase domain-containing protein 0.9845 45 315 GO:0005576
GO:0030600
GO:0045493
AF-A0A0A0C0G5-F1-model_v4 Cellulose-binding protein 0.9463 37 315 GO:0004553
GO:0005576
GO:0030247
GO:0030600
GO:0045493
AF-A0A6V8KHD8-F1-model_v4 CBM2 domain-containing protein 0.9449 56 315 GO:0004553
GO:0005576
GO:0030247
GO:0030600
GO:0045493
AF-A0A5M3YX85-F1-model_v4 Feruloyl esterase C (EC 3.1.1.73) (Ferulic acid esterase C) 0.942 60 315 GO:0005576
GO:0006508
GO:0008236
GO:0030600
GO:0045493

Feature Viewer

pLDDT pTM Quality
87.84 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map