F176602

General Info

Members Datasets Scaffolds Average Seq Length
139 91 139 279

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10215393|Ga0207674_102153932
Length 267
Sequence MAIIELKDVSKLYGFGDATTLALDGVSLSIDEGEFVAIMGPSGCGKSTLMNMIGLLDRPTHGDFLLGGRKVSRLKPNRAAKIRRDTIGFIFQSFNLLPRLTALENVALPLTYRTNMSQTKRLKMASSILERVGMQEREYFLPGQLSGGQIQSVAIARALVNNPRLIIADEPTGNLDSNGSRLVMELLSEIHKMGNTILFVTHNPELTRYANRVIYMHDGQIIQDEATDIGQVAVTALRGMYKARKMTEEDDLAGVSALMKAKPHKDK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
61 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
62 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
67 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
73 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
74 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
75 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
77 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
78 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
79 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
80 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
81 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
82 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
85 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
86 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
87 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
88 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
89 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
90 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
91 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.37
Nodule 0
Rhizoplane 0.72
Rhizosphere 64.03
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10184284 3300003320 Bacteria 1338
2 rootL2_10196681 3300003322 Bacteria 6285
3 rootH1_10013094 3300003323 Bacteria 1496
4 Ga0070658_10000036 3300005327 Bacteria 143743
5 Ga0070658_10001672 3300005327 Bacteria 18713
6 Ga0070658_10004202 3300005327 Bacteria 11791
7 Ga0070658_10009221 3300005327 Bacteria 7934
8 Ga0070658_10246238 3300005327 Bacteria 1516
9 Ga0070666_10093860 3300005335 Bacteria 2063
10 Ga0070680_100005686 3300005336 Bacteria 9457
11 Ga0070680_100006719 3300005336 Bacteria 8764
12 Ga0070682_100224174 3300005337 Bacteria 1340
13 Ga0070682_100238278 3300005337 Bacteria 1305
14 Ga0070671_100000001 3300005355 Bacteria 1228151
15 Ga0070671_100013539 3300005355 Bacteria 6577
16 Ga0070674_100005710 3300005356 Bacteria 7217
17 Ga0070667_100000001 3300005367 Bacteria 1108638
18 Ga0070663_100231236 3300005455 Bacteria 1456
19 Ga0070679_100003216 3300005530 Bacteria 14925
20 Ga0070679_100003285 3300005530 Bacteria 14796
21 Ga0070679_100004121 3300005530 Bacteria 13404
22 Ga0070679_100095424 3300005530 Bacteria 2961
23 Ga0070665_100017757 3300005548 Bacteria 7144
24 Ga0068855_100038696 3300005563 Bacteria 5666
25 Ga0068855_100265187 3300005563 Bacteria 1912
26 Ga0068857_100198378 3300005577 Bacteria 1829
27 Ga0068860_100135145 3300005843 Bacteria 2368
28 Ga0075365_10000031 3300006038 Bacteria 56060
29 Ga0075365_10203798 3300006038 Unclassified 1386
30 Ga0075365_10385539 3300006038 Unclassified 989
31 Ga0075368_10000146 3300006042 Bacteria 18837
32 Ga0075363_100001755 3300006048 Bacteria 8458
33 Ga0075364_10089229 3300006051 Bacteria 2045
34 Ga0075364_10113892 3300006051 Bacteria 1807
35 Ga0075362_10079460 3300006177 Bacteria 1510
36 Ga0075367_10000212 3300006178 Bacteria 19408
37 Ga0075369_10000015 3300006186 Bacteria 57194
38 Ga0075366_10000001 3300006195 Bacteria 569172
39 Ga0075366_10000050 3300006195 Bacteria 42254
40 Ga0075366_10009254 3300006195 Bacteria 5500
41 Ga0097621_100000002 3300006237 Bacteria 172240
42 Ga0075370_10002976 3300006353 Bacteria 7965
43 Ga0075370_10016319 3300006353 Bacteria 3994
44 Ga0068871_100000101 3300006358 Bacteria 51177
45 Ga0105245_10000001 3300009098 Bacteria 939270
46 Ga0105245_10000002 3300009098 Bacteria 634374
47 Ga0105241_10003398 3300009174 Bacteria 11846
48 Ga0105242_10002054 3300009176 Bacteria 15877
49 Ga0105248_10639716 3300009177 Bacteria 1200
50 Ga0105238_10106229 3300009551 Bacteria 2789
51 Ga0105239_10029115 3300010375 Bacteria 6071
52 Ga0105239_10051998 3300010375 Bacteria 4491
53 Ga0157371_10000702 3300013102 Bacteria 39329
54 Ga0157374_10000018 3300013296 Bacteria 286683
55 Ga0157374_10037599 3300013296 Bacteria 4444
56 Ga0207647_10003950 3300025904 Bacteria 11069
57 Ga0207705_10000011 3300025909 Bacteria 517768
58 Ga0207705_10000241 3300025909 Bacteria 53785
59 Ga0207705_10031732 3300025909 Bacteria 3773
60 Ga0207654_10011362 3300025911 Bacteria 4543
61 Ga0207660_10005864 3300025917 Bacteria 7975
62 Ga0207660_10008560 3300025917 Bacteria 6622
63 Ga0207657_10001388 3300025919 Bacteria 25841
64 Ga0207652_10001319 3300025921 Bacteria 22030
65 Ga0207652_10012644 3300025921 Bacteria 6825
66 Ga0207652_10017728 3300025921 Bacteria 5831
67 Ga0207652_10046443 3300025921 Bacteria 3705
68 Ga0207687_10000001 3300025927 Bacteria 1130810
69 Ga0207687_10000004 3300025927 Bacteria 841177
70 Ga0207644_10000001 3300025931 Bacteria 1243214
71 Ga0207644_10035423 3300025931 Bacteria 3497
72 Ga0207686_10063423 3300025934 Bacteria 2350
73 Ga0207709_10173075 3300025935 Bacteria 1517
74 Ga0207667_10268835 3300025949 Bacteria 1743
75 Ga0207668_10018386 3300025972 Bacteria 4397
76 Ga0207658_10000003 3300025986 Bacteria 1151934
77 Ga0207639_10014888 3300026041 Bacteria 5478
78 Ga0207674_10215393 3300026116 Bacteria 1869
79 Ga0209813_10000002 3300027866 Bacteria 215993
80 Ga0265334_10047203 3300028573 Bacteria 1662
81 Ga0265338_10001732 3300028800 Bacteria 34529
82 Ga0265338_10098482 3300028800 Bacteria 2392
83 Ga0265327_10000017 3300031251 Bacteria 445264
84 Ga0265327_10006344 3300031251 Bacteria 9491
85 Ga0395899_0008317 3300037312 Bacteria 7987
86 Ga0395899_0010751 3300037312 Bacteria 7018
87 Ga0395900_0000781 3300037418 Bacteria 42249
88 Ga0395900_0136354 3300037418 Bacteria 2514
89 Ga0395898_0015110 3300037466 Bacteria 7924
90 Ga0395898_0062091 3300037466 Bacteria 3629
91 Ga0395898_0064175 3300037466 Bacteria 3562
92 Ga0395905_0001909 3300037471 Bacteria 23975
93 Ga0395905_0128190 3300037471 Bacteria 2386
94 Ga0395905_0161044 3300037471 Bacteria 2109
95 Ga0395901_0001569 3300038443 Bacteria 23673
96 Ga0395901_0020757 3300038443 Bacteria 6725
97 Ga0395901_0045814 3300038443 Bacteria 4540
98 Ga0395901_0227250 3300038443 Bacteria 1949
99 Ga0495622_0000224 3300046557 Bacteria 44888
100 Ga0495588_0000238 3300046674 Bacteria 47796
101 Ga0495649_0000076 3300046694 Bacteria 84939
102 Ga0495600_0153272 3300046809 Bacteria 1491
103 Ga0495672_0000016 3300047320 Bacteria 500601
104 Ga0495676_0031548 3300047321 Bacteria 4479
105 Ga0495593_0220663 3300047673 Bacteria 951
106 Ga0495602_0341510 3300048088 Bacteria 1083
107 Ga0496112_0076762 3300048915 Bacteria 3304
108 Ga0496125_0096959 3300048928 Bacteria 2187
109 Ga0501034_0521475 3300049571 Bacteria 1100
110 Ga0501070_0252298 3300049586 Bacteria 1443
111 nmdc:mga03683_12175_c1 3300050489 Bacteria 2275
112 nmdc:mga03n38_780_c1 3300050490 Bacteria 8458
113 nmdc:mga00v17_15835_c1 3300050491 Bacteria 4240
114 nmdc:mga00v17_99846_c1 3300050491 Bacteria 1831
115 nmdc:mga0yw44_249766_c1 3300050492 Unclassified 1180
116 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
117 nmdc:mga0yw44_6195_c3 3300050492 Bacteria 4115
118 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
119 nmdc:mga0k408_28_c1 3300050493 Bacteria 92977
120 nmdc:mga0k408_4990_c1 3300050493 Bacteria 7030
121 nmdc:mga0k408_81420_c1 3300050493 Bacteria 1896
122 nmdc:mga06z11_42_c1 3300050494 Bacteria 52869
123 nmdc:mga06z11_45_c1 3300050494 Bacteria 52129
124 nmdc:mga04h51_25361_c1 3300050495 Bacteria 1824
125 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
126 nmdc:mga07m45_4318_c1 3300050496 Bacteria 6954
127 nmdc:mga0sz30_4_c2 3300050516 Bacteria 152717
128 Ga0500643_000010 3300053087 Bacteria 408084
129 Ga0500643_000261 3300053087 Bacteria 46785
130 Ga0500644_0001637 3300053088 Bacteria 5851
131 Ga0500583_0064489 3300053092 Bacteria 1737
132 Ga0500566_0000001 3300053094 Bacteria 1101031
133 Ga0500562_000002 3300053108 Bacteria 977234
134 Ga0500594_0000646 3300053118 Bacteria 7442
135 Ga0500614_000093 3300053123 Bacteria 20745
136 Ga0500628_000021 3300053129 Bacteria 78345
137 Ga0500655_038379 3300053133 Bacteria 936
138 Ga0500589_006129 3300053147 Bacteria 4774
139 Ga0500649_000026 3300053722 Bacteria 32554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10051998 Ga0105239_100519984 263
2 3300005577 Ga0068857_100198378 Ga0068857_1001983782 266
3 3300026116 Ga0207674_10215393 Ga0207674_102153932 266
4 3300009174 Ga0105241_10003398 Ga0105241_100033984 269
5 3300025911 Ga0207654_10011362 Ga0207654_100113624 269
6 3300025972 Ga0207668_10018386 Ga0207668_100183865 269
7 3300050493 nmdc:mga0k408_4990_c1 nmdc:mga0k408_4990_c1_1839_2825 269
8 3300050494 nmdc:mga06z11_45_c1 nmdc:mga06z11_45_c1_39961_40947 269
9 3300050495 nmdc:mga04h51_25361_c1 nmdc:mga04h51_25361_c1_395_1381 269
10 3300006237 Ga0097621_100000002 Ga0097621_10000000275 270
11 3300006358 Ga0068871_100000101 Ga0068871_1000001016 270
12 3300009098 Ga0105245_10000002 Ga0105245_10000002521 270
13 3300013296 Ga0157374_10000018 Ga0157374_10000018146 270
14 3300025927 Ga0207687_10000001 Ga0207687_10000001690 270
15 3300031251 Ga0265327_10006344 Ga0265327_100063443 270
16 3300037312 Ga0395899_0010751 Ga0395899_0010751_3624_4502 270
17 3300037418 Ga0395900_0136354 Ga0395900_0136354_709_1587 270
18 3300037466 Ga0395898_0062091 Ga0395898_0062091_1642_2520 270
19 3300037471 Ga0395905_0128190 Ga0395905_0128190_800_1678 270
20 3300038443 Ga0395901_0020757 Ga0395901_0020757_5017_5895 270
21 3300046557 Ga0495622_0000224 Ga0495622_0000224_23416_24300 270
22 3300046809 Ga0495600_0153272 Ga0495600_0153272_459_1343 270
23 3300047673 Ga0495593_0220663 Ga0495593_0220663_54_938 270
24 3300048088 Ga0495602_0341510 Ga0495602_0341510_107_991 270
25 3300053094 Ga0500566_0000001 Ga0500566_0000001_871182_872066 270
26 3300005327 Ga0070658_10009221 Ga0070658_100092217 271
27 3300005336 Ga0070680_100005686 Ga0070680_10000568610 271
28 3300005337 Ga0070682_100238278 Ga0070682_1002382781 271
29 3300005530 Ga0070679_100003285 Ga0070679_10000328512 271
30 3300006038 Ga0075365_10203798 Ga0075365_102037982 271
31 3300006195 Ga0075366_10000050 Ga0075366_1000005029 271
32 3300025909 Ga0207705_10031732 Ga0207705_100317322 271
33 3300025917 Ga0207660_10008560 Ga0207660_100085604 271
34 3300025921 Ga0207652_10001319 Ga0207652_1000131910 271
35 3300005327 Ga0070658_10246238 Ga0070658_102462382 272
36 3300005563 Ga0068855_100265187 Ga0068855_1002651873 272
37 3300006186 Ga0075369_10000015 Ga0075369_1000001559 272
38 3300006195 Ga0075366_10000001 Ga0075366_10000001163 272
39 3300006195 Ga0075366_10009254 Ga0075366_100092545 272
40 3300025949 Ga0207667_10268835 Ga0207667_102688352 272
41 3300046674 Ga0495588_0000238 Ga0495588_0000238_5537_6409 272
42 3300047321 Ga0495676_0031548 Ga0495676_0031548_1484_2356 272
43 3300050492 nmdc:mga0yw44_249766_c1 nmdc:mga0yw44_249766_c1_198_1079 272
44 3300050493 nmdc:mga0k408_28_c1 nmdc:mga0k408_28_c1_81412_82293 272
45 3300053088 Ga0500644_0001637 Ga0500644_0001637_3016_3903 272
46 3300053118 Ga0500594_0000646 Ga0500594_0000646_4357_5244 272
47 3300053129 Ga0500628_000021 Ga0500628_000021_77261_78148 272
48 3300053722 Ga0500649_000026 Ga0500649_000026_1396_2268 272
49 3300003323 rootH1_10013094 rootH1_100130942 273
50 3300005327 Ga0070658_10004202 Ga0070658_100042023 273
51 3300005530 Ga0070679_100004121 Ga0070679_1000041217 273
52 3300005563 Ga0068855_100038696 Ga0068855_1000386963 273
53 3300006051 Ga0075364_10089229 Ga0075364_100892292 273
54 3300006353 Ga0075370_10016319 Ga0075370_100163194 273
55 3300009177 Ga0105248_10639716 Ga0105248_106397162 273
56 3300025919 Ga0207657_10001388 Ga0207657_1000138814 273
57 3300025935 Ga0207709_10173075 Ga0207709_101730752 273
58 3300049571 Ga0501034_0521475 Ga0501034_0521475_59_934 273
59 3300050491 nmdc:mga00v17_99846_c1 nmdc:mga00v17_99846_c1_507_1379 273
60 3300050492 nmdc:mga0yw44_6195_c3 nmdc:mga0yw44_6195_c3_2417_3289 273
61 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_917429_918322 273
62 3300050493 nmdc:mga0k408_81420_c1 nmdc:mga0k408_81420_c1_945_1823 273
63 3300050496 nmdc:mga07m45_4318_c1 nmdc:mga07m45_4318_c1_65_946 273
64 3300050516 nmdc:mga0sz30_4_c2 nmdc:mga0sz30_4_c2_84049_84942 273
65 3300053087 Ga0500643_000010 Ga0500643_000010_148009_148884 273
66 3300003320 rootH2_10184284 rootH2_101842842 274
67 3300003322 rootL2_10196681 rootL2_101966811 274
68 3300005327 Ga0070658_10000036 Ga0070658_10000036137 274
69 3300005327 Ga0070658_10001672 Ga0070658_100016722 274
70 3300005335 Ga0070666_10093860 Ga0070666_100938602 274
71 3300005336 Ga0070680_100006719 Ga0070680_10000671911 274
72 3300005337 Ga0070682_100224174 Ga0070682_1002241742 274
73 3300005355 Ga0070671_100000001 Ga0070671_100000001244 274
74 3300005355 Ga0070671_100013539 Ga0070671_1000135394 274
75 3300005356 Ga0070674_100005710 Ga0070674_1000057105 274
76 3300005367 Ga0070667_100000001 Ga0070667_100000001996 274
77 3300005455 Ga0070663_100231236 Ga0070663_1002312362 274
78 3300005530 Ga0070679_100003216 Ga0070679_10000321612 274
79 3300005530 Ga0070679_100095424 Ga0070679_1000954242 274
80 3300005548 Ga0070665_100017757 Ga0070665_1000177576 274
81 3300005843 Ga0068860_100135145 Ga0068860_1001351452 274
82 3300006038 Ga0075365_10000031 Ga0075365_1000003116 274
83 3300006038 Ga0075365_10385539 Ga0075365_103855391 274
84 3300006042 Ga0075368_10000146 Ga0075368_1000014620 274
85 3300006048 Ga0075363_100001755 Ga0075363_1000017554 274
86 3300006051 Ga0075364_10113892 Ga0075364_101138922 274
87 3300006177 Ga0075362_10079460 Ga0075362_100794602 274
88 3300006178 Ga0075367_10000212 Ga0075367_1000021221 274
89 3300006353 Ga0075370_10002976 Ga0075370_100029766 274
90 3300009098 Ga0105245_10000001 Ga0105245_10000001160 274
91 3300009176 Ga0105242_10002054 Ga0105242_100020548 274
92 3300009551 Ga0105238_10106229 Ga0105238_101062294 274
93 3300010375 Ga0105239_10029115 Ga0105239_100291154 274
94 3300013102 Ga0157371_10000702 Ga0157371_100007025 274
95 3300013296 Ga0157374_10037599 Ga0157374_100375995 274
96 3300025904 Ga0207647_10003950 Ga0207647_1000395011 274
97 3300025909 Ga0207705_10000011 Ga0207705_10000011458 274
98 3300025909 Ga0207705_10000241 Ga0207705_1000024144 274
99 3300025917 Ga0207660_10005864 Ga0207660_100058643 274
100 3300025921 Ga0207652_10012644 Ga0207652_100126443 274
101 3300025921 Ga0207652_10017728 Ga0207652_100177285 274
102 3300025921 Ga0207652_10046443 Ga0207652_100464434 274
103 3300025927 Ga0207687_10000004 Ga0207687_10000004107 274
104 3300025931 Ga0207644_10000001 Ga0207644_100000011193 274
105 3300025931 Ga0207644_10035423 Ga0207644_100354234 274
106 3300025934 Ga0207686_10063423 Ga0207686_100634233 274
107 3300025986 Ga0207658_10000003 Ga0207658_10000003385 274
108 3300026041 Ga0207639_10014888 Ga0207639_100148882 274
109 3300027866 Ga0209813_10000002 Ga0209813_100000027 274
110 3300028573 Ga0265334_10047203 Ga0265334_100472032 274
111 3300028800 Ga0265338_10001732 Ga0265338_1000173238 274
112 3300028800 Ga0265338_10098482 Ga0265338_100984824 274
113 3300031251 Ga0265327_10000017 Ga0265327_10000017382 274
114 3300037312 Ga0395899_0008317 Ga0395899_0008317_2733_3623 274
115 3300037418 Ga0395900_0000781 Ga0395900_0000781_26366_27256 274
116 3300037466 Ga0395898_0015110 Ga0395898_0015110_2198_3076 274
117 3300037466 Ga0395898_0064175 Ga0395898_0064175_2594_3484 274
118 3300037471 Ga0395905_0001909 Ga0395905_0001909_12601_13482 274
119 3300037471 Ga0395905_0161044 Ga0395905_0161044_544_1422 274
120 3300038443 Ga0395901_0001569 Ga0395901_0001569_17637_18527 274
121 3300038443 Ga0395901_0045814 Ga0395901_0045814_579_1466 274
122 3300038443 Ga0395901_0227250 Ga0395901_0227250_62_946 274
123 3300046694 Ga0495649_0000076 Ga0495649_0000076_61873_62772 274
124 3300047320 Ga0495672_0000016 Ga0495672_0000016_258702_259643 274
125 3300048915 Ga0496112_0076762 Ga0496112_0076762_1666_2532 274
126 3300048928 Ga0496125_0096959 Ga0496125_0096959_1170_2093 274
127 3300049586 Ga0501070_0252298 Ga0501070_0252298_468_1346 274
128 3300050489 nmdc:mga03683_12175_c1 nmdc:mga03683_12175_c1_520_1401 274
129 3300050490 nmdc:mga03n38_780_c1 nmdc:mga03n38_780_c1_1332_2213 274
130 3300050491 nmdc:mga00v17_15835_c1 nmdc:mga00v17_15835_c1_761_1642 274
131 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_514769_515650 274
132 3300050494 nmdc:mga06z11_42_c1 nmdc:mga06z11_42_c1_6270_7151 274
133 3300050495 nmdc:mga04h51_2_c1 nmdc:mga04h51_2_c1_208837_209718 274
134 3300053087 Ga0500643_000261 Ga0500643_000261_24058_25035 274
135 3300053092 Ga0500583_0064489 Ga0500583_0064489_47_1024 274
136 3300053108 Ga0500562_000002 Ga0500562_000002_43817_44713 274
137 3300053123 Ga0500614_000093 Ga0500614_000093_1383_2255 274
138 3300053133 Ga0500655_038379 Ga0500655_038379_49_921 274
139 3300053147 Ga0500589_006129 Ga0500589_006129_1300_2277 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

23

173

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9443 4 227
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9414 1 224
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9379 1 227
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.935 3 221
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9349 1 225
ID Description Score Start End Superfamily
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9502 1 226 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9451 1 220 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9449 1 226 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9419 1 226 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9414 1 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A822J4P3-F1-model_v4 Partial putative ABC transporter ATP-binding protein YknY (EC 3.6.3.-) 0.976 58 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A854DBZ5-F1-model_v4 deleted 0.9752 108 221
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9711 23 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A822J4P3-F1-model_v4 Partial putative ABC transporter ATP-binding protein YknY (EC 3.6.3.-) 0.9703 58 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4D4IZA3-F1-model_v4 Glycine/betaine ABC transporter ATP-binding protein 0.9679 23 225 GO:0005524
GO:0006865
GO:0016020
GO:0016887
GO:0031460

Feature Viewer

pLDDT pTM Quality
81.59 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map