F176323

General Info

Members Datasets Scaffolds Average Seq Length
139 83 138 339

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10276086|Ga0157374_102760862
Length 369
Sequence MDKQNVKVAKETMIAMNSGGDRTPKIMNKILTKSLVAAAALALAIGCSQKQEVVKAQTLLNGAGSPFDNPAFMMWKEAYAKIDKDIQINYQSVGSGAGIKQLTSQTVDFGASDAPMTDEAMKTAPGKILHIPIVAGAVAITYNLPGAPKLKFDDATLSGIYLGTITKWNDPKIAALNSGVTLPATDIIVVHRADGSGTSFIFTDYLSTVNQDWAKKVGKSTSVNWPTGVGGKGSEGVSGQVKQLPGAIGYVELAYAEQNKLPVAELKNAAGKFVAPSPESVSQAMSTATIPDDFRFSMVNAPGDGSYPIAGASWVLLYEKQGDAKKGKLLVNFLKWCVTEGQKTSPQLSYAPLPESVQQRELKLLETVK

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
38 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
51 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
54 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
66 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
82 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10018718 3300003320 Bacteria 16064
2 Ga0070683_100007398 3300005329 Bacteria 9276
3 Ga0070683_100040743 3300005329 Unclassified 4271
4 Ga0070680_100084176 3300005336 Bacteria 2627
5 Ga0070691_10025287 3300005341 Bacteria 2764
6 Ga0070714_100205290 3300005435 Bacteria 1804
7 Ga0070713_100210631 3300005436 Bacteria 1759
8 Ga0070711_100000950 3300005439 Bacteria 15342
9 Ga0070681_10013907 3300005458 Bacteria 8008
10 Ga0070679_100111692 3300005530 Bacteria 2719
11 Ga0070684_100219599 3300005535 Bacteria 1734
12 Ga0068855_100015366 3300005563 Bacteria 9216
13 Ga0068855_100175790 3300005563 Bacteria 2423
14 Ga0068856_100000067 3300005614 Bacteria 98357
15 Ga0068856_100232395 3300005614 Bacteria 1859
16 Ga0070712_100316297 3300006175 Unclassified 1268
17 Ga0075436_100104092 3300006914 Bacteria 1978
18 Ga0099794_10001945 3300007265 Bacteria 7440
19 Ga0105240_10014651 3300009093 Bacteria 10699
20 Ga0157370_10359941 3300013104 Bacteria 1341
21 Ga0157369_10272640 3300013105 Bacteria 1763
22 Ga0157369_10360556 3300013105 Bacteria 1509
23 Ga0157374_10276086 3300013296 Bacteria 1658
24 Ga0157372_10039072 3300013307 Bacteria 5238
25 Ga0213876_10000585 3300021384 Bacteria 27120
26 Ga0213876_10000897 3300021384 Bacteria 19896
27 Ga0207707_10080880 3300025912 Bacteria 2837
28 Ga0207695_10022083 3300025913 Bacteria 7239
29 Ga0207695_10064803 3300025913 Bacteria 3760
30 Ga0207663_10001971 3300025916 Bacteria 9723
31 Ga0207664_10165176 3300025929 Bacteria 1891
32 Ga0207661_10001522 3300025944 Bacteria 15736
33 Ga0207661_10109129 3300025944 Bacteria 2337
34 Ga0207679_10227367 3300025945 Bacteria 1573
35 Ga0207667_10079615 3300025949 Bacteria 3396
36 Ga0207702_10001092 3300026078 Bacteria 27756
37 Ga0209588_1006158 3300027671 Plasmid 3473
38 Ga0209588_1013486 3300027671 Unclassified 2491
39 Ga0265337_1000553 3300028556 Bacteria 19769
40 Ga0265337_1011232 3300028556 Eukaryota 3096
41 Ga0265337_1012015 3300028556 Unclassified 2959
42 Ga0265337_1012606 3300028556 Bacteria 2866
43 Ga0265337_1035978 3300028556 Bacteria 1447
44 Ga0265326_10014203 3300028558 Bacteria 2320
45 Ga0265319_1000004 3300028563 Bacteria 305085
46 Ga0265319_1000080 3300028563 Bacteria 75462
47 Ga0265319_1003638 3300028563 Bacteria 7967
48 Ga0265319_1015393 3300028563 Bacteria 2967
49 Ga0265334_10040510 3300028573 Bacteria 1824
50 Ga0265334_10059585 3300028573 Bacteria 1442
51 Ga0265318_10002042 3300028577 Bacteria 11132
52 Ga0265318_10033716 3300028577 Bacteria 1975
53 Ga0265323_10000587 3300028653 Bacteria 20017
54 Ga0265322_10015828 3300028654 Bacteria 2177
55 Ga0265336_10010391 3300028666 Bacteria 3187
56 Ga0265336_10015766 3300028666 Bacteria 2480
57 Ga0265338_10000016 3300028800 Bacteria 347424
58 Ga0265338_10000382 3300028800 Bacteria 79298
59 Ga0265338_10003154 3300028800 Bacteria 23528
60 Ga0265338_10007112 3300028800 Bacteria 14017
61 Ga0265338_10008854 3300028800 Bacteria 12136
62 Ga0265338_10011655 3300028800 Bacteria 10126
63 Ga0265338_10017673 3300028800 Bacteria 7671
64 Ga0265338_10020306 3300028800 Bacteria 6999
65 Ga0265338_10039916 3300028800 Bacteria 4417
66 Ga0265338_10046266 3300028800 Bacteria 3989
67 Ga0265338_10046840 3300028800 Bacteria 3957
68 Ga0265338_10056986 3300028800 Bacteria 3460
69 Ga0265338_10059968 3300028800 Bacteria 3348
70 Ga0265324_10048448 3300029957 Unclassified 1461
71 Ga0265320_10000058 3300031240 Bacteria 102441
72 Ga0265320_10000823 3300031240 Bacteria 23388
73 Ga0265320_10007793 3300031240 Bacteria 6614
74 Ga0265320_10011829 3300031240 Bacteria 5114
75 Ga0265320_10020278 3300031240 Bacteria 3607
76 Ga0265320_10021739 3300031240 Unclassified 3445
77 Ga0265320_10030589 3300031240 Bacteria 2774
78 Ga0265325_10004610 3300031241 Bacteria 8656
79 Ga0265340_10001439 3300031247 Bacteria 13655
80 Ga0265340_10046568 3300031247 Bacteria 2115
81 Ga0265339_10018464 3300031249 Bacteria 4109
82 Ga0265327_10000029 3300031251 Bacteria 352607
83 Ga0265316_10018306 3300031344 Bacteria 6022
84 Ga0265316_10044070 3300031344 Bacteria 3550
85 Ga0265316_10066229 3300031344 Bacteria 2796
86 Ga0265316_10083156 3300031344 Bacteria 2452
87 Ga0265313_10000385 3300031595 Bacteria 47503
88 Ga0265313_10005257 3300031595 Bacteria 9585
89 Ga0265313_10005403 3300031595 Bacteria 9416
90 Ga0265313_10015567 3300031595 Bacteria 4419
91 Ga0265314_10020496 3300031711 Bacteria 5104
92 Ga0265314_10023363 3300031711 Bacteria 4715
93 Ga0265314_10069010 3300031711 Unclassified 2374
94 Ga0373953_0011828 3300035117 Bacteria 3076
95 Ga0373954_0028037 3300035118 Bacteria 2587
96 Ga0373956_0011915 3300035119 Bacteria 3594
97 Ga0373943_0033101 3300035170 Bacteria 2460
98 Ga0373946_0013768 3300035171 Bacteria 3044
99 Ga0373935_0010437 3300035692 Bacteria 5570
100 Ga0373927_0000848 3300035695 Bacteria 23328
101 Ga0373937_0130892 3300036401 Bacteria 2343
102 Ga0373925_0002040 3300037068 Bacteria 16664
103 Ga0373925_0400695 3300037068 Bacteria 1119
104 Ga0395905_0086713 3300037471 Bacteria 2935
105 Ga0436365_0338121 3300039437 Bacteria 6143
106 Ga0436365_1451485 3300039437 Bacteria 15599
107 Ga0436365_1460106 3300039437 Bacteria 6858
108 Ga0451576_0247301 3300045051 Bacteria 1864
109 Ga0495618_0001186 3300046514 Bacteria 17655
110 Ga0495630_0003164 3300046517 Bacteria 11426
111 Ga0495630_0047276 3300046517 Bacteria 3218
112 Ga0495666_0019211 3300046526 Bacteria 3394
113 Ga0495586_0001421 3300046535 Bacteria 13244
114 Ga0495586_0110687 3300046535 Bacteria 1528
115 Ga0495622_0058245 3300046557 Bacteria 1789
116 Ga0495667_0014300 3300046559 Bacteria 5361
117 Ga0495634_0022051 3300046642 Bacteria 4489
118 Ga0495635_0115855 3300046663 Bacteria 1829
119 Ga0495647_0029933 3300046681 Bacteria 2017
120 Ga0495613_0000924 3300046689 Bacteria 22535
121 Ga0495680_0006505 3300047322 Bacteria 10845
122 Ga0495680_0025764 3300047322 Bacteria 4863
123 Ga0495684_0156996 3300047471 Bacteria 1699
124 Ga0501031_0000004 3300049568 Bacteria 202781
125 Ga0501032_0195767 3300049569 Bacteria 1320
126 Ga0501033_0000212 3300049570 Bacteria 55695
127 Ga0501037_0231494 3300049573 Unclassified 1297
128 Ga0501043_0233184 3300049579 Bacteria 1421
129 Ga0501047_0158426 3300049581 Bacteria 2136
130 Ga0501080_0247477 3300049742 Bacteria 1626
131 Ga0501083_0003937 3300049744 Bacteria 10435
132 Ga0501083_0012768 3300049744 Bacteria 5875
133 Ga0501035_0039230 3300049822 Unclassified 4286
134 Ga0501035_0098327 3300049822 Bacteria 2569
135 Ga0501035_0129366 3300049822 Bacteria 2202
136 Ga0501035_0385877 3300049822 Bacteria 1168
137 Ga0501044_0001072 3300049823 Bacteria 32802
138 Ga0501044_0158467 3300049823 Bacteria 2242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10001945 Ga0099794_100019454 311
2 3300027671 Ga0209588_1013486 Ga0209588_10134862 311
3 3300028800 Ga0265338_10000382 Ga0265338_1000038228 312
4 3300035170 Ga0373943_0033101 Ga0373943_0033101_1506_2447 312
5 3300046557 Ga0495622_0058245 Ga0495622_0058245_10_972 316
6 3300013104 Ga0157370_10359941 Ga0157370_103599412 323
7 3300028666 Ga0265336_10010391 Ga0265336_100103912 328
8 3300031251 Ga0265327_10000029 Ga0265327_1000002915 328
9 3300037471 Ga0395905_0086713 Ga0395905_0086713_1242_2255 328
10 iso_pu_bacteria 2786546940 2788435190 328
11 3300005329 Ga0070683_100007398 Ga0070683_1000073982 329
12 3300005329 Ga0070683_100040743 Ga0070683_1000407432 329
13 3300005535 Ga0070684_100219599 Ga0070684_1002195991 329
14 3300005614 Ga0068856_100232395 Ga0068856_1002323951 329
15 3300006914 Ga0075436_100104092 Ga0075436_1001040921 329
16 3300013105 Ga0157369_10360556 Ga0157369_103605561 329
17 3300025944 Ga0207661_10001522 Ga0207661_100015229 329
18 3300025944 Ga0207661_10109129 Ga0207661_101091292 329
19 3300028556 Ga0265337_1035978 Ga0265337_10359782 329
20 3300028563 Ga0265319_1000080 Ga0265319_100008012 329
21 3300028563 Ga0265319_1003638 Ga0265319_10036385 329
22 3300028577 Ga0265318_10002042 Ga0265318_100020422 329
23 3300028577 Ga0265318_10033716 Ga0265318_100337161 329
24 3300031240 Ga0265320_10000058 Ga0265320_1000005833 329
25 3300031240 Ga0265320_10000823 Ga0265320_100008238 329
26 3300031240 Ga0265320_10011829 Ga0265320_100118294 329
27 3300031240 Ga0265320_10030589 Ga0265320_100305892 329
28 3300031595 Ga0265313_10015567 Ga0265313_100155675 329
29 3300049579 Ga0501043_0233184 Ga0501043_0233184_157_1161 329
30 3300049744 Ga0501083_0003937 Ga0501083_0003937_2968_3975 329
31 3300049744 Ga0501083_0012768 Ga0501083_0012768_3396_4403 329
32 3300049822 Ga0501035_0385877 Ga0501035_0385877_102_1103 329
33 3300028800 Ga0265338_10007112 Ga0265338_100071126 330
34 3300035171 Ga0373946_0013768 Ga0373946_0013768_574_1581 330
35 3300035692 Ga0373935_0010437 Ga0373935_0010437_2890_3897 330
36 3300035695 Ga0373927_0000848 Ga0373927_0000848_11031_12038 330
37 3300037068 Ga0373925_0002040 Ga0373925_0002040_2893_3900 330
38 3300039437 Ga0436365_0338121 Ga0436365_0338121_3359_4372 330
39 3300046517 Ga0495630_0003164 Ga0495630_0003164_9296_10303 330
40 3300046526 Ga0495666_0019211 Ga0495666_0019211_786_1793 330
41 3300005336 Ga0070680_100084176 Ga0070680_1000841762 331
42 3300005341 Ga0070691_10025287 Ga0070691_100252872 331
43 3300005563 Ga0068855_100015366 Ga0068855_1000153662 331
44 3300005563 Ga0068855_100175790 Ga0068855_1001757902 331
45 3300013105 Ga0157369_10272640 Ga0157369_102726402 331
46 3300013296 Ga0157374_10276086 Ga0157374_102760862 331
47 3300013307 Ga0157372_10039072 Ga0157372_100390722 331
48 3300025913 Ga0207695_10022083 Ga0207695_100220832 331
49 3300025945 Ga0207679_10227367 Ga0207679_102273671 331
50 3300025949 Ga0207667_10079615 Ga0207667_100796152 331
51 3300027671 Ga0209588_1006158 Ga0209588_10061582 331
52 3300028800 Ga0265338_10046266 Ga0265338_100462662 331
53 3300031711 Ga0265314_10020496 Ga0265314_100204961 331
54 3300037068 Ga0373925_0400695 Ga0373925_0400695_53_1066 331
55 3300005435 Ga0070714_100205290 Ga0070714_1002052901 332
56 3300005436 Ga0070713_100210631 Ga0070713_1002106312 332
57 3300005439 Ga0070711_100000950 Ga0070711_10000095012 332
58 3300005458 Ga0070681_10013907 Ga0070681_100139076 332
59 3300005530 Ga0070679_100111692 Ga0070679_1001116923 332
60 3300006175 Ga0070712_100316297 Ga0070712_1003162971 332
61 3300009093 Ga0105240_10014651 Ga0105240_100146513 332
62 3300021384 Ga0213876_10000585 Ga0213876_1000058517 332
63 3300021384 Ga0213876_10000897 Ga0213876_1000089716 332
64 3300025912 Ga0207707_10080880 Ga0207707_100808803 332
65 3300025913 Ga0207695_10064803 Ga0207695_100648033 332
66 3300025916 Ga0207663_10001971 Ga0207663_100019712 332
67 3300025929 Ga0207664_10165176 Ga0207664_101651762 332
68 3300028556 Ga0265337_1011232 Ga0265337_10112322 332
69 3300028573 Ga0265334_10059585 Ga0265334_100595852 332
70 3300028800 Ga0265338_10011655 Ga0265338_100116555 332
71 3300028800 Ga0265338_10017673 Ga0265338_100176732 332
72 3300028800 Ga0265338_10020306 Ga0265338_100203066 332
73 3300028800 Ga0265338_10039916 Ga0265338_100399162 332
74 3300028800 Ga0265338_10056986 Ga0265338_100569862 332
75 3300028800 Ga0265338_10059968 Ga0265338_100599682 332
76 3300031240 Ga0265320_10020278 Ga0265320_100202784 332
77 3300031247 Ga0265340_10046568 Ga0265340_100465681 332
78 3300031344 Ga0265316_10066229 Ga0265316_100662291 332
79 3300031344 Ga0265316_10083156 Ga0265316_100831562 332
80 3300031595 Ga0265313_10005257 Ga0265313_100052572 332
81 3300031711 Ga0265314_10023363 Ga0265314_100233634 332
82 3300039437 Ga0436365_1451485 Ga0436365_1451485_9804_10832 332
83 3300039437 Ga0436365_1460106 Ga0436365_1460106_1448_2518 332
84 3300045051 Ga0451576_0247301 Ga0451576_0247301_460_1482 332
85 3300046535 Ga0495586_0110687 Ga0495586_0110687_324_1337 332
86 3300028556 Ga0265337_1012606 Ga0265337_10126062 333
87 3300028563 Ga0265319_1000004 Ga0265319_1000004290 333
88 3300028800 Ga0265338_10046840 Ga0265338_100468403 333
89 3300031240 Ga0265320_10007793 Ga0265320_100077934 333
90 3300031247 Ga0265340_10001439 Ga0265340_100014398 333
91 3300031595 Ga0265313_10000385 Ga0265313_100003858 333
92 3300035117 Ga0373953_0011828 Ga0373953_0011828_1666_2682 333
93 3300035118 Ga0373954_0028037 Ga0373954_0028037_1300_2316 333
94 3300035119 Ga0373956_0011915 Ga0373956_0011915_2440_3456 333
95 3300036401 Ga0373937_0130892 Ga0373937_0130892_141_1157 333
96 3300046514 Ga0495618_0001186 Ga0495618_0001186_15960_16976 333
97 3300046517 Ga0495630_0047276 Ga0495630_0047276_1538_2617 333
98 3300046535 Ga0495586_0001421 Ga0495586_0001421_8669_9685 333
99 3300046559 Ga0495667_0014300 Ga0495667_0014300_2167_3246 333
100 3300046642 Ga0495634_0022051 Ga0495634_0022051_2452_3468 333
101 3300046663 Ga0495635_0115855 Ga0495635_0115855_129_1145 333
102 3300046681 Ga0495647_0029933 Ga0495647_0029933_821_1837 333
103 3300046689 Ga0495613_0000924 Ga0495613_0000924_9390_10406 333
104 3300047322 Ga0495680_0006505 Ga0495680_0006505_782_1798 333
105 3300047322 Ga0495680_0025764 Ga0495680_0025764_1003_2082 333
106 3300047471 Ga0495684_0156996 Ga0495684_0156996_275_1291 333
107 3300049569 Ga0501032_0195767 Ga0501032_0195767_206_1294 333
108 3300003320 rootH2_10018718 rootH2_100187183 334
109 3300005614 Ga0068856_100000067 Ga0068856_10000006723 334
110 3300026078 Ga0207702_10001092 Ga0207702_1000109221 334
111 3300028556 Ga0265337_1000553 Ga0265337_100055321 334
112 3300028556 Ga0265337_1012015 Ga0265337_10120152 334
113 3300028558 Ga0265326_10014203 Ga0265326_100142032 334
114 3300028563 Ga0265319_1015393 Ga0265319_10153931 334
115 3300028573 Ga0265334_10040510 Ga0265334_100405102 334
116 3300028653 Ga0265323_10000587 Ga0265323_100005871 334
117 3300028654 Ga0265322_10015828 Ga0265322_100158281 334
118 3300028666 Ga0265336_10015766 Ga0265336_100157661 334
119 3300028800 Ga0265338_10000016 Ga0265338_10000016215 334
120 3300028800 Ga0265338_10003154 Ga0265338_100031543 334
121 3300028800 Ga0265338_10008854 Ga0265338_100088542 334
122 3300029957 Ga0265324_10048448 Ga0265324_100484483 334
123 3300031240 Ga0265320_10021739 Ga0265320_100217393 334
124 3300031241 Ga0265325_10004610 Ga0265325_100046107 334
125 3300031249 Ga0265339_10018464 Ga0265339_100184643 334
126 3300031344 Ga0265316_10018306 Ga0265316_100183062 334
127 3300031344 Ga0265316_10044070 Ga0265316_100440704 334
128 3300031595 Ga0265313_10005403 Ga0265313_100054038 334
129 3300031711 Ga0265314_10069010 Ga0265314_100690101 334
130 3300049568 Ga0501031_0000004 Ga0501031_0000004_161271_162275 334
131 3300049570 Ga0501033_0000212 Ga0501033_0000212_9733_10737 334
132 3300049573 Ga0501037_0231494 Ga0501037_0231494_110_1198 334
133 3300049581 Ga0501047_0158426 Ga0501047_0158426_840_1928 334
134 3300049742 Ga0501080_0247477 Ga0501080_0247477_407_1426 334
135 3300049822 Ga0501035_0039230 Ga0501035_0039230_1287_2375 334
136 3300049822 Ga0501035_0098327 Ga0501035_0098327_475_1479 334
137 3300049822 Ga0501035_0129366 Ga0501035_0129366_245_1264 334
138 3300049823 Ga0501044_0001072 Ga0501044_0001072_27408_28412 334
139 3300049823 Ga0501044_0158467 Ga0501044_0158467_177_1196 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

50

340

0.88

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

67

343

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9539 21 324
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9528 22 334
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.9525 17 334
1a55-assembly1.cif.gz_A phosphate-binding protein mutant a197c 0.9524 21 334
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9519 21 334
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9626 99 273 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9566 100 273 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9519 99 273 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9494 101 273 3.40.190.10
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9434 20 85 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V5PJC1-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9958 75 334 GO:0035435
GO:0042301
GO:0043190
AF-A0A2V5PJC1-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9919 75 334 GO:0035435
GO:0042301
GO:0043190
AF-A0A7C5I7P8-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.982 74 333 GO:0035435
GO:0042301
GO:0043190
AF-A0A2V8EPN9-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9795 102 273 GO:0035435
GO:0042301
GO:0043190
AF-A0A1Q7M8L9-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9775 127 334 GO:0035435
GO:0042301
GO:0043190

Feature Viewer

pLDDT pTM Quality
90.74 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map