F174822

General Info

Members Datasets Scaffolds Average Seq Length
138 117 276 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997451912|2997457449
Length 321
Sequence FRTQDSGDTTNIADGTAVTLTTAPSGPAPGSATPDAAPQGPSAPDSSLLDLSVLDLAAVEAAVRKAAADEIMPRFQQLAAEDIVQKNGPHDLVTVADRLAEEHLTAALTALLPGSKVVGEEAVHADPKVLDALHGDAPVWIVDPVDGTRQFVHGDPGFATLVALAHHGEVLASWTYAPALDLMAVARRGAGAELNGVPLHTGSPAADAVLDVAISHFDFTSDDEKRVLAALDTNGVAPRPCGSAGLEYLHIARGEIDAIAFSWENAWDHAAGLLLVHEAGGASGTLAGQPFRIGGGNALPFTAARDAETARRILGLLAAAN

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
3 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
4 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
5 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
6 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
7 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
8 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
9 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
10 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
11 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
12 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
13 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
14 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
15 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
16 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
17 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
18 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
19 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
20 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
21 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
22 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
23 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
24 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
25 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
26 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
27 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
28 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
29 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
30 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
31 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
32 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
33 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
34 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
35 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
36 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
37 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
38 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
39 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
40 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
41 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
42 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
43 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
44 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
50 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
52 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
59 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
60 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
61 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
62 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
63 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
64 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
65 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
66 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
67 2643221548 Streptomyces sp. Root55 Isolate Unclassified
68 2643221578 Streptomyces sp. Root63 Isolate Unclassified
69 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
70 2643221647 Streptomyces sp. Root369 Isolate Unclassified
71 2643221670 Streptomyces sp. Root431 Isolate Unclassified
72 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
73 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
74 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
75 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
76 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
77 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
78 2808606448 Streptomyces sp. 193411 Isolate Unclassified
79 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
80 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
81 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
82 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
83 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
84 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
85 2867369537 Streptomyces sp. Z26 Isolate Unclassified
86 2867428634 Streptomyces sp. RP5T Isolate Unclassified
87 2867475112 Streptomyces sp. TM32 Isolate Unclassified
88 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
89 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
90 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
91 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
92 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
93 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
94 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
95 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
96 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
97 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
98 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
99 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
100 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
101 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
102 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
103 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
104 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
105 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
106 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
107 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
108 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
109 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
110 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
111 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
112 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
113 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
114 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
115 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
116 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
117 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 59.42
Metatranscriptomes 0
Isolates 40.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.72
Rhizoplane 2.17
Rhizosphere 71.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1007267 3300003354 Bacteria 4355
2 Ga0075363_100002046 3300006048 Bacteria 8053
3 Ga0099826_10043954 3300006948 Bacteria 3070
4 Ga0105251_10014185 3300009011 Bacteria 4420
5 Ga0209758_1003365 3300025297 Bacteria 14652
6 Ga0207426_1000849 3300025302 Bacteria 32135
7 Ga0207426_1001041 3300025302 Bacteria 26411
8 Ga0207426_1012459 3300025302 Bacteria 3191
9 Ga0209371_1007380 3300027312 Bacteria 3843
10 Ga0268256_1009887 3300030500 Bacteria 3127
11 Ga0307508_10021118 3300031616 Bacteria 5921
12 Ga0307508_10040679 3300031616 Bacteria 4172
13 Ga0307514_10006205 3300031649 Bacteria 10477
14 Ga0307514_10020364 3300031649 Bacteria 5413
15 Ga0307516_10005528 3300031730 Bacteria 15072
16 Ga0307516_10018445 3300031730 Bacteria 7252
17 Ga0395900_0088323 3300037418 Bacteria 3187
18 Ga0395898_0274511 3300037466 Bacteria 1608
19 Ga0439436_0005756 3300041404 Bacteria 3798
20 Ga0439439_0019883 3300041406 Bacteria 1668
21 Ga0439432_052860 3300042006 Bacteria 1264
22 Ga0439457_001733 3300042014 Bacteria 6470
23 Ga0466969_0035814 3300044656 Bacteria 2509
24 Ga0466969_0066895 3300044656 Bacteria 1734
25 Ga0466972_0004124 3300044658 Bacteria 7252
26 Ga0466972_0011704 3300044658 Bacteria 4405
27 Ga0466965_0004369 3300044683 Bacteria 6284
28 Ga0466966_0013568 3300044684 Bacteria 5392
29 Ga0466966_0015483 3300044684 Bacteria 5041
30 Ga0466961_0002525 3300044693 Bacteria 11352
31 Ga0466961_0011465 3300044693 Bacteria 5669
32 Ga0466963_0000884 3300044694 Bacteria 15225
33 Ga0466964_0001342 3300044706 Bacteria 8397
34 Ga0466971_0025541 3300044719 Bacteria 2638
35 Ga0466970_0000307 3300044765 Bacteria 23833
36 Ga0466957_0001926 3300044842 Bacteria 11012
37 Ga0466960_0038580 3300044901 Bacteria 2247
38 Ga0466958_0020940 3300045836 Bacteria 3817
39 Ga0466967_0100074 3300045976 Bacteria 2648
40 Ga0495603_0001911 3300046455 Bacteria 12290
41 Ga0495603_0005473 3300046455 Bacteria 7582
42 Ga0495629_0000847 3300046459 Bacteria 24697
43 Ga0495629_0001263 3300046459 Bacteria 19881
44 Ga0495629_0018958 3300046459 Bacteria 4920
45 Ga0495639_0015629 3300046475 Bacteria 3292
46 Ga0495585_0079711 3300046492 Bacteria 1776
47 Ga0495594_0000327 3300046499 Bacteria 23636
48 Ga0495608_0045616 3300046511 Bacteria 2920
49 Ga0495667_0222345 3300046559 Bacteria 1205
50 Ga0495613_0006788 3300046689 Bacteria 8544
51 Ga0495613_0076059 3300046689 Bacteria 2443
52 Ga0495604_0123634 3300047317 Bacteria 1869
53 Ga0495676_0001741 3300047321 Bacteria 19018
54 Ga0495676_0004740 3300047321 Bacteria 12444
55 Ga0495614_0000462 3300048089 Bacteria 16694
56 Ga0496106_0010764 3300048909 Bacteria 6759
57 Ga0496113_0220520 3300048916 Bacteria 1511
58 Ga0501031_0004733 3300049568 Bacteria 8831
59 Ga0501032_0005164 3300049569 Bacteria 9737
60 Ga0501032_0113684 3300049569 Bacteria 1791
61 Ga0501033_0018979 3300049570 Bacteria 5198
62 Ga0501034_0011313 3300049571 Bacteria 9256
63 Ga0501034_0087696 3300049571 Bacteria 3111
64 Ga0501037_0010038 3300049573 Bacteria 6945
65 Ga0501038_0044234 3300049574 Bacteria 3871
66 Ga0501039_0283174 3300049575 Bacteria 1303
67 Ga0501042_0023302 3300049578 Bacteria 4331
68 Ga0501043_0123239 3300049579 Bacteria 2033
69 Ga0501046_0052686 3300049580 Bacteria 3206
70 Ga0501047_0014100 3300049581 Bacteria 7595
71 Ga0501048_0010228 3300049582 Bacteria 7016
72 Ga0501048_0133807 3300049582 Bacteria 1751
73 Ga0501035_0064316 3300049822 Bacteria 3260
74 Ga0501035_0404486 3300049822 Bacteria 1135
75 Ga0501035_0455982 3300049822 Bacteria 1057
76 Ga0501044_0000295 3300049823 Bacteria 63284
77 Ga0501044_0070567 3300049823 Bacteria 3553
78 Ga0501044_0126593 3300049823 Bacteria 2551
79 Ga0501045_0366555 3300049824 Bacteria 1072
80 nmdc:mga03n38_106876_c1 3300050490 Bacteria 1357
81 Ga0500573_0130689 3300053140 Bacteria 1391
82 Ga0466962_0000548 3300061719 Bacteria 16567
83 2997457449 2997451912 Bacteria 8492419
84 2547410261 2547132111 Bacteria 8013147
85 2585300849 2582581312 Bacteria 7308206
86 2585304611 2582581313 Bacteria 10042643
87 2616901514 2616644941 Bacteria 8510691
88 2643762024 2643221548 Bacteria 8053412
89 2643902022 2643221578 Bacteria 9213798
90 2643946262 2643221587 Bacteria 7586415
91 2644261999 2643221647 Bacteria 10741251
92 2644388033 2643221670 Bacteria 6497041
93 2644408166 2643221673 Bacteria 9196637
94 2644433051 2643221677 Bacteria 7584031
95 2644460549 2643221682 Bacteria 6743283
96 2768646149 2767802112 Bacteria 6465194
97 2785340128 2784746763 Bacteria 9783172
98 2793976375 2791355406 Bacteria 11364898
99 2809235237 2808606448 Bacteria 8656184
100 2811843552 2808606982 Bacteria 7791042
101 2812477683 2811994917 Bacteria 7761064
102 2862183974 2862178590 Bacteria 8583590
103 2862283442 2862281513 Bacteria 9621493
104 2862294904 2862290372 Bacteria 7471434
105 2867350618 2867346516 Bacteria 7608576
106 2867374639 2867369537 Bacteria 6501581
107 2867429150 2867428634 Bacteria 9590268
108 2867475220 2867475112 Bacteria 6909112
109 2873152956 2873151551 Bacteria 8625867
110 2875397677 2875391855 Bacteria 7600475
111 2918507457 2918501144 Bacteria 8668083
112 2935395368 2935390628 Bacteria 7043367
113 2946046855 2946045630 Bacteria 8527308
114 2954382886 2954380949 Bacteria 10050426
115 2954708817 2954701450 Bacteria 10834262
116 2954713358 2954711539 Bacteria 10867210
117 2954723319 2954721474 Bacteria 10456478
118 2954738509 2954731030 Bacteria 10243860
119 2954742225 2954740390 Bacteria 10229294
120 2954757368 2954749733 Bacteria 10366972
121 2954761203 2954759201 Bacteria 9358192
122 2966599869 2966598605 Bacteria 7676064
123 2990049105 2990044586 Bacteria 6603797
124 2990091753 2990088156 Bacteria 6657676
125 2997603481 2997600082 Bacteria 9896405
126 3006427110 3006425503 Bacteria 6491253
127 3006494183 3006493962 Bacteria 8825450
128 8025417495 8025413630 Bacteria 7014048
129 8025479403 8025478263 Bacteria 8209203
130 8047895338 8047893842 Bacteria 11723082
131 8048130627 8048127548 Bacteria 11053136
132 8048363615 8048356638 Bacteria 11044339
133 8048372364 8048369669 Bacteria 11666822
134 8048381298 8048379754 Bacteria 11877923
135 8048407024 8048406513 Bacteria 8936924
136 8054161875 8054160619 Bacteria 7783213
137 8056448898 8056447290 Bacteria 7680491
138 8056667252 8056667051 Bacteria 6953971
139 JGI25160J50197_1007267
140 Ga0075363_100002046
141 Ga0099826_10043954
142 Ga0105251_10014185
143 Ga0209758_1003365
144 Ga0207426_1000849
145 Ga0207426_1001041
146 Ga0207426_1012459
147 Ga0209371_1007380
148 Ga0268256_1009887
149 Ga0307508_10021118
150 Ga0307508_10040679
151 Ga0307514_10006205
152 Ga0307514_10020364
153 Ga0307516_10005528
154 Ga0307516_10018445
155 Ga0395900_0088323
156 Ga0395898_0274511
157 Ga0439436_0005756
158 Ga0439439_0019883
159 Ga0439432_052860
160 Ga0439457_001733
161 Ga0466969_0035814
162 Ga0466969_0066895
163 Ga0466972_0004124
164 Ga0466972_0011704
165 Ga0466965_0004369
166 Ga0466966_0013568
167 Ga0466966_0015483
168 Ga0466961_0002525
169 Ga0466961_0011465
170 Ga0466963_0000884
171 Ga0466964_0001342
172 Ga0466971_0025541
173 Ga0466970_0000307
174 Ga0466957_0001926
175 Ga0466960_0038580
176 Ga0466958_0020940
177 Ga0466967_0100074
178 Ga0495603_0001911
179 Ga0495603_0005473
180 Ga0495629_0000847
181 Ga0495629_0001263
182 Ga0495629_0018958
183 Ga0495639_0015629
184 Ga0495585_0079711
185 Ga0495594_0000327
186 Ga0495608_0045616
187 Ga0495667_0222345
188 Ga0495613_0006788
189 Ga0495613_0076059
190 Ga0495604_0123634
191 Ga0495676_0001741
192 Ga0495676_0004740
193 Ga0495614_0000462
194 Ga0496106_0010764
195 Ga0496113_0220520
196 Ga0501031_0004733
197 Ga0501032_0005164
198 Ga0501032_0113684
199 Ga0501033_0018979
200 Ga0501034_0011313
201 Ga0501034_0087696
202 Ga0501037_0010038
203 Ga0501038_0044234
204 Ga0501039_0283174
205 Ga0501042_0023302
206 Ga0501043_0123239
207 Ga0501046_0052686
208 Ga0501047_0014100
209 Ga0501048_0010228
210 Ga0501048_0133807
211 Ga0501035_0064316
212 Ga0501035_0404486
213 Ga0501035_0455982
214 Ga0501044_0000295
215 Ga0501044_0070567
216 Ga0501044_0126593
217 Ga0501045_0366555
218 nmdc:mga03n38_106876_c1
219 Ga0500573_0130689
220 Ga0466962_0000548
221 2997457449
222 2547410261
223 2585300849
224 2585304611
225 2616901514
226 2643762024
227 2643902022
228 2643946262
229 2644261999
230 2644388033
231 2644408166
232 2644433051
233 2644460549
234 2768646149
235 2785340128
236 2793976375
237 2809235237
238 2811843552
239 2812477683
240 2862183974
241 2862283442
242 2862294904
243 2867350618
244 2867374639
245 2867429150
246 2867475220
247 2873152956
248 2875397677
249 2918507457
250 2935395368
251 2946046855
252 2954382886
253 2954708817
254 2954713358
255 2954723319
256 2954738509
257 2954742225
258 2954757368
259 2954761203
260 2966599869
261 2990049105
262 2990091753
263 2997603481
264 3006427110
265 3006494183
266 8025417495
267 8025479403
268 8047895338
269 8048130627
270 8048363615
271 8048372364
272 8048381298
273 8048407024
274 8054161875
275 8056448898
276 8056667252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

50

317

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcr-assembly1.cif.gz_A crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.889 9 271
5i3s-assembly2.cif.gz_D crystal structure of staphylococcal impase-ii 0.8717 11 268
2pcr-assembly1.cif.gz_D crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.8637 9 267
2p3v-assembly1.cif.gz_A thermotoga maritima impase tm1415 0.8587 13 270
2pcr-assembly1.cif.gz_C crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.8556 1 271
ID Description Score Start End Superfamily
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9129 12 149 3.30.540.10
af_Q7KTW5_4_149_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9101 4 149 3.30.540.10
af_Q9VP62_273_418_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8996 10 147 3.30.540.10
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8878 1 149 3.30.540.10
af_Q7KTW5_4_149_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8866 4 149 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A6G3XQF8-F1-model_v4 Inositol monophosphatase 0.9864 89 225 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A540VYX1-F1-model_v4 Inositol monophosphatase 0.9794 1 271 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A2T7K731-F1-model_v4 deleted 0.9774 7 268
AF-A0A540VYX1-F1-model_v4 Inositol monophosphatase 0.9759 1 271 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A6G3XQF8-F1-model_v4 Inositol monophosphatase 0.9723 89 225 GO:0006020
GO:0007165
GO:0008934
GO:0046872

Map