F174476

General Info

Members Datasets Scaffolds Average Seq Length
138 95 276 116

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0215187|Ga0501068_0215187_660_1067
Length 135
Sequence MAPTLENLHREPARGSGRIDPVAVTGWTVLALVFLDELLAMAGLGVYGWSTPARWLLVWLLPLLAMLAWFLFASPKARFGSAMVRPLVKILVFGLASWGLWAAGHHALAVALLVFSVVVNGLAQLPSIRVLAEQD

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
60 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
61 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 2643221617 Nocardioides sp. Root79 Isolate Unclassified
93 2643221620 Nocardioides sp. Root240 Isolate Unclassified
94 2738541305 Nocardioides sp. CF167 Isolate Unclassified
95 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 2.9
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.12
Nodule 0
Rhizoplane 5.8
Rhizosphere 68.84
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0215187 3300049584 Bacteria 1221
2 Ga0006562J51391_1127724 3300003578 Bacteria 1892
3 Ga0006562J51391_1127725 3300003578 Bacteria 2020
4 Ga0070658_10279415 3300005327 Bacteria 1421
5 Ga0070683_100105444 3300005329 Bacteria 2657
6 Ga0070683_100546030 3300005329 Bacteria 1108
7 Ga0070680_101094455 3300005336 Bacteria 689
8 Ga0070660_100123460 3300005339 Bacteria 2068
9 Ga0070660_100387546 3300005339 Bacteria 1154
10 Ga0070661_100449591 3300005344 Bacteria 1025
11 Ga0070673_101251069 3300005364 Bacteria 696
12 Ga0070659_100423410 3300005366 Bacteria 1126
13 Ga0070667_100105736 3300005367 Bacteria 2436
14 Ga0070667_101533866 3300005367 Bacteria 626
15 Ga0070663_100060797 3300005455 Bacteria 2719
16 Ga0070663_100703469 3300005455 Bacteria 859
17 Ga0070662_100105611 3300005457 Bacteria 2138
18 Ga0070698_100684727 3300005471 Bacteria 967
19 Ga0070679_100211585 3300005530 Bacteria 1903
20 Ga0068853_100681958 3300005539 Bacteria 979
21 Ga0070672_101571315 3300005543 Bacteria 590
22 Ga0070664_101616534 3300005564 Bacteria 614
23 Ga0068857_100674163 3300005577 Bacteria 981
24 Ga0068863_100996761 3300005841 Bacteria 840
25 Ga0075365_10002399 3300006038 Bacteria 9173
26 Ga0075365_10021671 3300006038 Bacteria 4012
27 Ga0075365_10049764 3300006038 Bacteria 2762
28 Ga0075365_10247068 3300006038 Bacteria 1253
29 Ga0075365_10565037 3300006038 Bacteria 804
30 Ga0075365_10644670 3300006038 Bacteria 749
31 Ga0075368_10206939 3300006042 Bacteria 831
32 Ga0075363_100037052 3300006048 Bacteria 2560
33 Ga0075363_100095132 3300006048 Bacteria 1643
34 Ga0075363_100538215 3300006048 Unclassified 696
35 Ga0075364_10188481 3300006051 Bacteria 1396
36 Ga0075364_10276723 3300006051 Bacteria 1142
37 Ga0075367_10233551 3300006178 Bacteria 1152
38 Ga0111539_11485337 3300009094 Bacteria 786
39 Ga0105237_10159354 3300009545 Bacteria 2254
40 Ga0105239_10002798 3300010375 Bacteria 21821
41 Ga0157372_12097863 3300013307 Bacteria 649
42 Ga0157375_10561913 3300013308 Bacteria 1302
43 Ga0163163_10307631 3300014325 Bacteria 1637
44 Ga0163163_10832697 3300014325 Bacteria 986
45 Ga0157377_10634235 3300014745 Bacteria 767
46 Ga0163161_10791380 3300017792 Bacteria 796
47 Ga0206353_10037082 3300020082 Bacteria 1040
48 Ga0206353_11692754 3300020082 Bacteria 2586
49 Ga0213875_10053357 3300021388 Bacteria 1893
50 Ga0207692_11187966 3300025898 Bacteria 506
51 Ga0207705_10264874 3300025909 Bacteria 1313
52 Ga0207671_10841813 3300025914 Bacteria 726
53 Ga0207657_10110360 3300025919 Bacteria 2272
54 Ga0207657_10333163 3300025919 Bacteria 1198
55 Ga0207649_10167527 3300025920 Bacteria 1527
56 Ga0207652_10095338 3300025921 Bacteria 2621
57 Ga0207652_11517474 3300025921 Bacteria 574
58 Ga0207706_10042522 3300025933 Bacteria 4027
59 Ga0207706_11578848 3300025933 Unclassified 532
60 Ga0207691_10218784 3300025940 Bacteria 1652
61 Ga0207679_10410061 3300025945 Bacteria 1194
62 Ga0207651_10902848 3300025960 Bacteria 787
63 Ga0207658_11289647 3300025986 Bacteria 668
64 Ga0207639_10636679 3300026041 Bacteria 986
65 Ga0207639_11386049 3300026041 Bacteria 660
66 Ga0207678_10067409 3300026067 Bacteria 3073
67 Ga0207678_10849040 3300026067 Bacteria 807
68 Ga0207641_10620134 3300026088 Bacteria 1060
69 Ga0207641_11151099 3300026088 Bacteria 775
70 Ga0207674_10021924 3300026116 Bacteria 6869
71 Ga0207698_11185941 3300026142 Bacteria 777
72 Ga0209813_10067962 3300027866 Bacteria 1153
73 Ga0268264_10000387 3300028381 Bacteria 63349
74 Ga0268264_11225807 3300028381 Bacteria 760
75 Ga0307410_10799938 3300031852 Bacteria 802
76 Ga0307409_100348380 3300031995 Bacteria 1397
77 Ga0307409_100372491 3300031995 Bacteria 1355
78 Ga0307416_102564585 3300032002 Bacteria 608
79 Ga0307416_102715780 3300032002 Bacteria 592
80 Ga0436364_0082500 3300037853 Bacteria 4516
81 Ga0436364_0989186 3300037853 Bacteria 1996
82 Ga0395901_0247169 3300038443 Bacteria 1859
83 Ga0395901_0388755 3300038443 Bacteria 1435
84 Ga0395901_0643782 3300038443 Bacteria 1064
85 Ga0451793_1392145 3300041452 Bacteria 807
86 Ga0451797_1060105 3300041453 Bacteria 694
87 Ga0451833_0409632 3300041491 Bacteria 819
88 Ga0451843_0661312 3300041509 Unclassified 603
89 Ga0466972_0006039 3300044658 Bacteria 6086
90 Ga0466965_0079153 3300044683 Bacteria 1660
91 Ga0466966_0407693 3300044684 Bacteria 817
92 Ga0466961_0173094 3300044693 Bacteria 1342
93 Ga0466963_0009493 3300044694 Bacteria 5859
94 Ga0466964_0084462 3300044706 Bacteria 1369
95 Ga0466971_0034484 3300044719 Bacteria 2268
96 Ga0466968_0493763 3300044735 Bacteria 609
97 Ga0466970_0800650 3300044765 Bacteria 552
98 Ga0466960_0044727 3300044901 Bacteria 2112
99 Ga0466958_0075645 3300045836 Bacteria 2066
100 Ga0466967_0089450 3300045976 Bacteria 2796
101 Ga0466967_0155885 3300045976 Bacteria 2139
102 Ga0466967_1408000 3300045976 Bacteria 694
103 Ga0496102_0109414 3300048905 Bacteria 2575
104 Ga0496108_0258099 3300048911 Bacteria 1516
105 Ga0496109_0029144 3300048912 Bacteria 4942
106 Ga0496110_0070211 3300048913 Bacteria 3103
107 Ga0496111_0031039 3300048914 Bacteria 3804
108 Ga0496115_0026631 3300048918 Bacteria 4515
109 Ga0501034_1644923 3300049571 Bacteria 515
110 Ga0501041_0265812 3300049577 Bacteria 1079
111 Ga0501068_0015371 3300049584 Bacteria 4394
112 Ga0501068_0668495 3300049584 Bacteria 678
113 Ga0501070_0008286 3300049586 Bacteria 8786
114 Ga0501070_0066216 3300049586 Bacteria 2991
115 Ga0501070_0142495 3300049586 Bacteria 1979
116 Ga0501070_0672495 3300049586 Bacteria 821
117 Ga0501070_0749770 3300049586 Bacteria 769
118 Ga0501071_0323173 3300049587 Bacteria 1172
119 Ga0501072_0110930 3300049588 Bacteria 2184
120 Ga0501072_0957750 3300049588 Bacteria 668
121 Ga0501076_0324371 3300049592 Bacteria 1263
122 Ga0501045_0057394 3300049824 Bacteria 2849
123 nmdc:mga03n38_58288_c1 3300050490 Bacteria 1749
124 nmdc:mga03n38_71993_c1 3300050490 Bacteria 1601
125 nmdc:mga00v17_179833_c1 3300050491 Bacteria 1365
126 nmdc:mga00v17_31426_c2 3300050491 Bacteria 1949
127 nmdc:mga0yw44_1442_c1 3300050492 Bacteria 9436
128 nmdc:mga0yw44_162122_c1 3300050492 Bacteria 1464
129 nmdc:mga0yw44_207002_c1 3300050492 Bacteria 1297
130 nmdc:mga0yw44_245591_c2 3300050492 Bacteria 917
131 nmdc:mga0yw44_290735_c1 3300050492 Bacteria 1093
132 nmdc:mga0yw44_294711_c1 3300050492 Bacteria 1086
133 nmdc:mga06z11_258753_c1 3300050494 Unclassified 1026
134 Ga0501084_0375648 3300054114 Bacteria 1201
135 2644100669 2643221617 Bacteria 5139111
136 2644117077 2643221620 Bacteria 5134593
137 2738869559 2738541305 Bacteria 4910150
138 2919448726 2919446982 Bacteria 3994487
139 Ga0501068_0215187
140 Ga0006562J51391_1127724
141 Ga0006562J51391_1127725
142 Ga0070658_10279415
143 Ga0070683_100105444
144 Ga0070683_100546030
145 Ga0070680_101094455
146 Ga0070660_100123460
147 Ga0070660_100387546
148 Ga0070661_100449591
149 Ga0070673_101251069
150 Ga0070659_100423410
151 Ga0070667_100105736
152 Ga0070667_101533866
153 Ga0070663_100060797
154 Ga0070663_100703469
155 Ga0070662_100105611
156 Ga0070698_100684727
157 Ga0070679_100211585
158 Ga0068853_100681958
159 Ga0070672_101571315
160 Ga0070664_101616534
161 Ga0068857_100674163
162 Ga0068863_100996761
163 Ga0075365_10002399
164 Ga0075365_10021671
165 Ga0075365_10049764
166 Ga0075365_10247068
167 Ga0075365_10565037
168 Ga0075365_10644670
169 Ga0075368_10206939
170 Ga0075363_100037052
171 Ga0075363_100095132
172 Ga0075363_100538215
173 Ga0075364_10188481
174 Ga0075364_10276723
175 Ga0075367_10233551
176 Ga0111539_11485337
177 Ga0105237_10159354
178 Ga0105239_10002798
179 Ga0157372_12097863
180 Ga0157375_10561913
181 Ga0163163_10307631
182 Ga0163163_10832697
183 Ga0157377_10634235
184 Ga0163161_10791380
185 Ga0206353_10037082
186 Ga0206353_11692754
187 Ga0213875_10053357
188 Ga0207692_11187966
189 Ga0207705_10264874
190 Ga0207671_10841813
191 Ga0207657_10110360
192 Ga0207657_10333163
193 Ga0207649_10167527
194 Ga0207652_10095338
195 Ga0207652_11517474
196 Ga0207706_10042522
197 Ga0207706_11578848
198 Ga0207691_10218784
199 Ga0207679_10410061
200 Ga0207651_10902848
201 Ga0207658_11289647
202 Ga0207639_10636679
203 Ga0207639_11386049
204 Ga0207678_10067409
205 Ga0207678_10849040
206 Ga0207641_10620134
207 Ga0207641_11151099
208 Ga0207674_10021924
209 Ga0207698_11185941
210 Ga0209813_10067962
211 Ga0268264_10000387
212 Ga0268264_11225807
213 Ga0307410_10799938
214 Ga0307409_100348380
215 Ga0307409_100372491
216 Ga0307416_102564585
217 Ga0307416_102715780
218 Ga0436364_0082500
219 Ga0436364_0989186
220 Ga0395901_0247169
221 Ga0395901_0388755
222 Ga0395901_0643782
223 Ga0451793_1392145
224 Ga0451797_1060105
225 Ga0451833_0409632
226 Ga0451843_0661312
227 Ga0466972_0006039
228 Ga0466965_0079153
229 Ga0466966_0407693
230 Ga0466961_0173094
231 Ga0466963_0009493
232 Ga0466964_0084462
233 Ga0466971_0034484
234 Ga0466968_0493763
235 Ga0466970_0800650
236 Ga0466960_0044727
237 Ga0466958_0075645
238 Ga0466967_0089450
239 Ga0466967_0155885
240 Ga0466967_1408000
241 Ga0496102_0109414
242 Ga0496108_0258099
243 Ga0496109_0029144
244 Ga0496110_0070211
245 Ga0496111_0031039
246 Ga0496115_0026631
247 Ga0501034_1644923
248 Ga0501041_0265812
249 Ga0501068_0015371
250 Ga0501068_0668495
251 Ga0501070_0008286
252 Ga0501070_0066216
253 Ga0501070_0142495
254 Ga0501070_0672495
255 Ga0501070_0749770
256 Ga0501071_0323173
257 Ga0501072_0110930
258 Ga0501072_0957750
259 Ga0501076_0324371
260 Ga0501045_0057394
261 nmdc:mga03n38_58288_c1
262 nmdc:mga03n38_71993_c1
263 nmdc:mga00v17_179833_c1
264 nmdc:mga00v17_31426_c2
265 nmdc:mga0yw44_1442_c1
266 nmdc:mga0yw44_162122_c1
267 nmdc:mga0yw44_207002_c1
268 nmdc:mga0yw44_245591_c2
269 nmdc:mga0yw44_290735_c1
270 nmdc:mga0yw44_294711_c1
271 nmdc:mga06z11_258753_c1
272 Ga0501084_0375648
273 2644100669
274 2644117077
275 2738869559
276 2919448726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10823

DUF2568

Protein of unknown function (DUF2568)

31

117

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzc-assembly2.cif.gz_J crystal structure of serine acetyltransferase from brucella abortus strain s19 0.4476 19 99
7kk8-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81t with bromide 0.4436 12 112
4hzc-assembly1.cif.gz_E crystal structure of serine acetyltransferase from brucella abortus strain s19 0.4262 21 101
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.4174 12 99
3ifx-assembly1.cif.gz_A crystal structure of the spin-labeled kcsa mutant v48r1 0.4026 1 91
ID Description Score Start End Superfamily
af_I1N2K4_53_258_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5282 16 100 1.25.40.10
af_Q22921_1_161_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4881 2 101 1.20.1070.10
af_Q9VL78_241_391_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4857 6 101 1.25.40.10
af_A0A0R0ID55_243_368_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4726 5 99 1.25.40.10
af_F1R4Z4_193_280_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4477 8 105 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A1V1VZS7-F1-model_v4 DUF2568 domain-containing protein 0.9821 3 116 GO:0016020
AF-A0A3L8NXU8-F1-model_v4 DUF2568 domain-containing protein 0.975 3 112 GO:0016020
AF-A0A3G9II36-F1-model_v4 DUF2568 domain-containing protein 0.9728 6 113 GO:0016020
AF-A0A3A5HAT9-F1-model_v4 DUF2568 domain-containing protein 0.9693 5 116 GO:0016020
AF-A0A3N0DTF7-F1-model_v4 DUF2568 domain-containing protein 0.9693 3 113 GO:0016020

Map