F174175

General Info

Members Datasets Scaffolds Average Seq Length
138 83 276 290

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0141483|Ga0495640_0141483_472_1521
Length 349
Sequence MVGSFHRDRCHRVSGGRDFFVGDCFSLTQTARPQTPSSPPPTSPLWQSIGTAAALHTDEVMQHSRAITKKSASNLALAFVLLPREKRDAMSALYAFCRAVDDVADEDSAPAEKRREQLSQWRADVKRACENQSPQFPVNQELQPVIQQFRLPFGLFDDLIKGCEMDLETKRYEDFEALENYCYHVASVVGLLSIEIFGHKNPTTRDYAIYLGKALQLTNILRDVKTDAARGRIYLPQSGLKKFDVAERDILNGNYSENYFALANSIADRAKHFYSLARKTLPPEDRKSMVAAELMGSVYWQLLKKLEANRFNVFGERPVRVCKPQKLALIFRAWLRFVCDSRTPNYGTP

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
26 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
30 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
31 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
35 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
43 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
44 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
45 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
46 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
47 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
48 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
49 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
50 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
51 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
52 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
53 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
73 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
74 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 0
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0141483 3300046533 Bacteria 1551
2 rootH2_10044254 3300003320 Bacteria 7232
3 Ga0070690_100027177 3300005330 Bacteria 3536
4 Ga0070689_100033000 3300005340 Bacteria 3942
5 Ga0070691_10058812 3300005341 Bacteria 1846
6 Ga0070711_100025944 3300005439 Bacteria 3837
7 Ga0070684_100414234 3300005535 Bacteria 1243
8 Ga0068855_100020678 3300005563 Bacteria 7893
9 Ga0068855_100024859 3300005563 Bacteria 7167
10 Ga0068855_100261207 3300005563 Bacteria 1929
11 Ga0068856_100000079 3300005614 Bacteria 92486
12 Ga0068864_100398002 3300005618 Bacteria 1308
13 Ga0081455_10120464 3300005937 Bacteria 2068
14 Ga0075430_100124302 3300006846 Bacteria 2151
15 Ga0075431_100085268 3300006847 Bacteria 3260
16 Ga0111539_10101860 3300009094 Bacteria 3371
17 Ga0105237_10143982 3300009545 Bacteria 2378
18 Ga0105238_10002482 3300009551 Bacteria 18465
19 Ga0207695_10020511 3300025913 Bacteria 7567
20 Ga0207695_10103156 3300025913 Bacteria 2844
21 Ga0207663_10013277 3300025916 Bacteria 4474
22 Ga0207694_10004337 3300025924 Bacteria 11076
23 Ga0207700_10182884 3300025928 Bacteria 1757
24 Ga0207670_10354074 3300025936 Bacteria 1163
25 Ga0207667_10021158 3300025949 Bacteria 7213
26 Ga0207667_10021924 3300025949 Bacteria 7070
27 Ga0207702_10003055 3300026078 Bacteria 15552
28 Ga0207676_10464818 3300026095 Bacteria 1195
29 Ga0265337_1000067 3300028556 Bacteria 48544
30 Ga0265337_1000102 3300028556 Bacteria 42139
31 Ga0265337_1000754 3300028556 Bacteria 17075
32 Ga0265337_1004515 3300028556 Bacteria 5758
33 Ga0265337_1012070 3300028556 Bacteria 2949
34 Ga0265326_10007489 3300028558 Bacteria 3343
35 Ga0265319_1000001 3300028563 Bacteria 549513
36 Ga0265319_1013284 3300028563 Bacteria 3283
37 Ga0265334_10010313 3300028573 Bacteria 3945
38 Ga0265318_10073213 3300028577 Bacteria 1269
39 Ga0265323_10003093 3300028653 Bacteria 7401
40 Ga0265323_10030346 3300028653 Bacteria 2014
41 Ga0265336_10000913 3300028666 Bacteria 14984
42 Ga0265338_10000242 3300028800 Bacteria 101378
43 Ga0265338_10001348 3300028800 Bacteria 39992
44 Ga0265338_10002530 3300028800 Bacteria 27106
45 Ga0265338_10002676 3300028800 Bacteria 26200
46 Ga0265338_10002770 3300028800 Bacteria 25657
47 Ga0265338_10003273 3300028800 Bacteria 23015
48 Ga0265338_10005718 3300028800 Bacteria 16079
49 Ga0265338_10006094 3300028800 Bacteria 15481
50 Ga0265338_10010747 3300028800 Bacteria 10683
51 Ga0265338_10012239 3300028800 Bacteria 9798
52 Ga0265338_10012902 3300028800 Bacteria 9491
53 Ga0265338_10032684 3300028800 Bacteria 5066
54 Ga0265338_10049623 3300028800 Bacteria 3802
55 Ga0265338_10056476 3300028800 Bacteria 3481
56 Ga0265338_10089532 3300028800 Bacteria 2550
57 Ga0265338_10152040 3300028800 Unclassified 1797
58 Ga0265338_10198728 3300028800 Unclassified 1513
59 Ga0265324_10000768 3300029957 Bacteria 21141
60 Ga0265324_10023237 3300029957 Bacteria 2209
61 Ga0265328_10039777 3300031239 Bacteria 1734
62 Ga0265320_10000711 3300031240 Bacteria 25479
63 Ga0265320_10000870 3300031240 Bacteria 22823
64 Ga0265320_10010723 3300031240 Bacteria 5434
65 Ga0265320_10012107 3300031240 Bacteria 5039
66 Ga0265320_10019751 3300031240 Bacteria 3673
67 Ga0265320_10021977 3300031240 Bacteria 3421
68 Ga0265340_10033251 3300031247 Bacteria 2568
69 Ga0265340_10042033 3300031247 Bacteria 2245
70 Ga0265327_10002080 3300031251 Bacteria 22363
71 Ga0265316_10000659 3300031344 Bacteria 38376
72 Ga0265316_10003620 3300031344 Bacteria 15574
73 Ga0265316_10055457 3300031344 Bacteria 3099
74 Ga0265316_10099182 3300031344 Bacteria 2216
75 Ga0265316_10101328 3300031344 Bacteria 2188
76 Ga0265316_10108272 3300031344 Bacteria 2107
77 Ga0265313_10001830 3300031595 Bacteria 19415
78 Ga0265313_10017202 3300031595 Unclassified 4119
79 Ga0265314_10018076 3300031711 Bacteria 5510
80 Ga0265314_10133642 3300031711 Bacteria 1544
81 Ga0265342_10146406 3300031712 Unclassified 1315
82 Ga0307410_10173522 3300031852 Bacteria 1627
83 Ga0373930_0001267 3300034816 Bacteria 3734
84 Ga0373928_0000011 3300035084 Bacteria 31163
85 Ga0373929_0000882 3300035085 Bacteria 5851
86 Ga0373944_0000019 3300035089 Bacteria 29600
87 Ga0373949_0002304 3300035090 Bacteria 4964
88 Ga0373951_0000712 3300035091 Bacteria 9135
89 Ga0373932_0000001 3300035112 Bacteria 1459067
90 Ga0373945_0009069 3300035116 Bacteria 3250
91 Ga0373954_0000157 3300035118 Bacteria 24231
92 Ga0373946_0015482 3300035171 Bacteria 2893
93 Ga0373962_0000055 3300035242 Bacteria 25343
94 Ga0373931_0000004 3300035691 Bacteria 535140
95 Ga0373927_0016190 3300035695 Bacteria 4921
96 Ga0373927_0016466 3300035695 Bacteria 4875
97 Ga0373927_0161456 3300035695 Bacteria 1468
98 Ga0373933_0062989 3300035724 Bacteria 2241
99 Ga0373947_0012154 3300035725 Bacteria 4929
100 Ga0373937_0018629 3300036401 Bacteria 6202
101 Ga0373925_0000046 3300037068 Bacteria 131256
102 Ga0373925_0005368 3300037068 Bacteria 9556
103 Ga0451577_0031772 3300042876 Bacteria 4762
104 Ga0451577_0170843 3300042876 Bacteria 1959
105 Ga0451576_0029615 3300045051 Bacteria 5858
106 Ga0451576_0373473 3300045051 Bacteria 1494
107 Ga0495592_0023979 3300046454 Bacteria 4640
108 Ga0495618_0001049 3300046514 Bacteria 18859
109 Ga0495628_0349898 3300046516 Bacteria 1086
110 Ga0495630_0318502 3300046517 Bacteria 1189
111 Ga0495652_0009622 3300046529 Bacteria 8777
112 Ga0495640_0060041 3300046533 Bacteria 2587
113 Ga0495586_0000121 3300046535 Bacteria 47320
114 Ga0495586_0008950 3300046535 Bacteria 5328
115 Ga0495634_0000333 3300046642 Bacteria 45524
116 Ga0495634_0166333 3300046642 Bacteria 1388
117 Ga0495635_0076253 3300046663 Unclassified 2298
118 Ga0495613_0000939 3300046689 Bacteria 22337
119 Ga0495674_0025978 3300047319 Bacteria 5360
120 Ga0495680_0002012 3300047322 Bacteria 21331
121 Ga0495684_0037838 3300047471 Unclassified 3701
122 Ga0495684_0132773 3300047471 Bacteria 1869
123 Ga0501031_0000475 3300049568 Bacteria 23374
124 Ga0501031_0052957 3300049568 Bacteria 2644
125 Ga0501032_0037643 3300049569 Bacteria 3298
126 Ga0501033_0000930 3300049570 Bacteria 26737
127 Ga0501033_0056707 3300049570 Bacteria 2895
128 Ga0501037_0067729 3300049573 Bacteria 2599
129 Ga0501043_0134915 3300049579 Bacteria 1934
130 Ga0501043_0183542 3300049579 Bacteria 1629
131 Ga0501047_0047047 3300049581 Bacteria 4169
132 Ga0501047_0504055 3300049581 Bacteria 1037
133 Ga0501080_0079528 3300049742 Bacteria 3048
134 Ga0501035_0003667 3300049822 Bacteria 14637
135 Ga0501035_0269579 3300049822 Bacteria 1441
136 Ga0501044_0000686 3300049823 Bacteria 40958
137 Ga0501044_0008932 3300049823 Bacteria 10955
138 Ga0500650_0013898 3300053098 Bacteria 3390
139 Ga0495640_0141483
140 rootH2_10044254
141 Ga0070690_100027177
142 Ga0070689_100033000
143 Ga0070691_10058812
144 Ga0070711_100025944
145 Ga0070684_100414234
146 Ga0068855_100020678
147 Ga0068855_100024859
148 Ga0068855_100261207
149 Ga0068856_100000079
150 Ga0068864_100398002
151 Ga0081455_10120464
152 Ga0075430_100124302
153 Ga0075431_100085268
154 Ga0111539_10101860
155 Ga0105237_10143982
156 Ga0105238_10002482
157 Ga0207695_10020511
158 Ga0207695_10103156
159 Ga0207663_10013277
160 Ga0207694_10004337
161 Ga0207700_10182884
162 Ga0207670_10354074
163 Ga0207667_10021158
164 Ga0207667_10021924
165 Ga0207702_10003055
166 Ga0207676_10464818
167 Ga0265337_1000067
168 Ga0265337_1000102
169 Ga0265337_1000754
170 Ga0265337_1004515
171 Ga0265337_1012070
172 Ga0265326_10007489
173 Ga0265319_1000001
174 Ga0265319_1013284
175 Ga0265334_10010313
176 Ga0265318_10073213
177 Ga0265323_10003093
178 Ga0265323_10030346
179 Ga0265336_10000913
180 Ga0265338_10000242
181 Ga0265338_10001348
182 Ga0265338_10002530
183 Ga0265338_10002676
184 Ga0265338_10002770
185 Ga0265338_10003273
186 Ga0265338_10005718
187 Ga0265338_10006094
188 Ga0265338_10010747
189 Ga0265338_10012239
190 Ga0265338_10012902
191 Ga0265338_10032684
192 Ga0265338_10049623
193 Ga0265338_10056476
194 Ga0265338_10089532
195 Ga0265338_10152040
196 Ga0265338_10198728
197 Ga0265324_10000768
198 Ga0265324_10023237
199 Ga0265328_10039777
200 Ga0265320_10000711
201 Ga0265320_10000870
202 Ga0265320_10010723
203 Ga0265320_10012107
204 Ga0265320_10019751
205 Ga0265320_10021977
206 Ga0265340_10033251
207 Ga0265340_10042033
208 Ga0265327_10002080
209 Ga0265316_10000659
210 Ga0265316_10003620
211 Ga0265316_10055457
212 Ga0265316_10099182
213 Ga0265316_10101328
214 Ga0265316_10108272
215 Ga0265313_10001830
216 Ga0265313_10017202
217 Ga0265314_10018076
218 Ga0265314_10133642
219 Ga0265342_10146406
220 Ga0307410_10173522
221 Ga0373930_0001267
222 Ga0373928_0000011
223 Ga0373929_0000882
224 Ga0373944_0000019
225 Ga0373949_0002304
226 Ga0373951_0000712
227 Ga0373932_0000001
228 Ga0373945_0009069
229 Ga0373954_0000157
230 Ga0373946_0015482
231 Ga0373962_0000055
232 Ga0373931_0000004
233 Ga0373927_0016190
234 Ga0373927_0016466
235 Ga0373927_0161456
236 Ga0373933_0062989
237 Ga0373947_0012154
238 Ga0373937_0018629
239 Ga0373925_0000046
240 Ga0373925_0005368
241 Ga0451577_0031772
242 Ga0451577_0170843
243 Ga0451576_0029615
244 Ga0451576_0373473
245 Ga0495592_0023979
246 Ga0495618_0001049
247 Ga0495628_0349898
248 Ga0495630_0318502
249 Ga0495652_0009622
250 Ga0495640_0060041
251 Ga0495586_0000121
252 Ga0495586_0008950
253 Ga0495634_0000333
254 Ga0495634_0166333
255 Ga0495635_0076253
256 Ga0495613_0000939
257 Ga0495674_0025978
258 Ga0495680_0002012
259 Ga0495684_0037838
260 Ga0495684_0132773
261 Ga0501031_0000475
262 Ga0501031_0052957
263 Ga0501032_0037643
264 Ga0501033_0000930
265 Ga0501033_0056707
266 Ga0501037_0067729
267 Ga0501043_0134915
268 Ga0501043_0183542
269 Ga0501047_0047047
270 Ga0501047_0504055
271 Ga0501080_0079528
272 Ga0501035_0003667
273 Ga0501035_0269579
274 Ga0501044_0000686
275 Ga0501044_0008932
276 Ga0500650_0013898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

68

325

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.8886 3 281
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.8882 3 254
3we9-assembly1.cif.gz_A the crystal structure of yisp from bacillus subtilis subsp. subtilis strain 168 0.8741 3 273
3vje-assembly2.cif.gz_B crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a 0.8731 2 278
4ea1-assembly1.cif.gz_A co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109 0.8716 2 278
ID Description Score Start End Superfamily
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8954 3 275 1.10.600.10
af_Q54E48_68_332_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8851 6 255 1.10.600.10
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8846 3 254 1.10.600.10
3we9A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8741 3 273 1.10.600.10
af_Q9VYS5_51_308_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8728 1 253 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A1V6DH56-F1-model_v4 deleted 0.9931 4 291
AF-A0A6N6Q5X5-F1-model_v4 Presqualene diphosphate synthase HpnD (EC 2.5.1.103) 0.993 6 288 GO:0004311
GO:0016117
GO:0016767
GO:0051996
AF-A0A383A0R1-F1-model_v4 Squalene synthase HpnD 0.993 4 235 GO:0004311
GO:0008299
GO:0051996
AF-A0A2E5EKZ2-F1-model_v4 Squalene synthase HpnD 0.9875 6 290 GO:0004311
GO:0016117
GO:0016767
GO:0051996
AF-A0A7V6EBM4-F1-model_v4 Squalene synthase HpnD 0.9863 4 291 GO:0004311
GO:0016117
GO:0051996

Map