F173401

General Info

Members Datasets Scaffolds Average Seq Length
138 89 276 456

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100134037|Ga0207675_1001340372
Length 505
Sequence LCRALGRSPPPRARAAARSGSTSGAVWTDFSPPPIFTITRFTRDLDALAFKTAPEVAALIRGGGVSAAEAVEFTLRRIEAADAQIGAFIEVDGDRALAEAAAIRARDPRPFAGVPIAVKGNVPVAGLCMSYASRLLTGYRPNHNAYLVRRLREAGFVVIGVTNLSEFGILPTTEPRHTGPTRNPWNLDRTPGGLVPIAHGNDGGGSIRIPAACTGLLGLKPSRGRISRGPDLGESYLGVEGVLTRTVTETAHLLDVLAGYEAGDATWAPRPAEPYATAVRRHPGRLRIAVSLENSLGVEVDAECVRAVHEAAGILRELGHEVVEASPSLPGRETLDVFLQVFGPAIALGVIFGELVAGHEAGEDDIEPLSRAVAAFARTLPSTGYLAALSQLQALARSTIAFFADHDLLLTPVLASRPLPIGELHGCGEDPMADLRRAGEFAPFTAIFNVTGQPAISVPLGFGEDGLPSAVQLVGRPLAEDTLLQVAAQLELTRPWAQHLPPTGA

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
65 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
77 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
88 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
89 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.72
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100134037 3300026118 Bacteria 2349
2 JGI25407J50210_10002177 3300003373 Bacteria 4582
3 Ga0070709_10000132 3300005434 Bacteria 49598
4 Ga0070714_100000946 3300005435 Bacteria 20656
5 Ga0070713_100000962 3300005436 Bacteria 18424
6 Ga0070710_10000414 3300005437 Bacteria 20052
7 Ga0070711_100003507 3300005439 Bacteria 9148
8 Ga0070706_100001069 3300005467 Bacteria 29617
9 Ga0070706_100010230 3300005467 Bacteria 8721
10 Ga0070707_100000067 3300005468 Bacteria 93995
11 Ga0070698_100001348 3300005471 Bacteria 27290
12 Ga0070698_100005221 3300005471 Bacteria 14203
13 Ga0070664_100084211 3300005564 Bacteria 2744
14 Ga0068864_100133010 3300005618 Bacteria 2237
15 Ga0081538_10000517 3300005981 Bacteria 43195
16 Ga0081538_10000624 3300005981 Bacteria 39292
17 Ga0081538_10001326 3300005981 Bacteria 25535
18 Ga0081538_10005110 3300005981 Bacteria 11918
19 Ga0081538_10005575 3300005981 Bacteria 11302
20 Ga0081538_10007907 3300005981 Bacteria 9109
21 Ga0081538_10013662 3300005981 Bacteria 6419
22 Ga0081538_10066616 3300005981 Bacteria 2017
23 Ga0081539_10002924 3300005985 Bacteria 22540
24 Ga0070717_10002433 3300006028 Bacteria 13135
25 Ga0070717_10044145 3300006028 Bacteria 3640
26 Ga0070716_100000264 3300006173 Bacteria 21027
27 Ga0070712_100000793 3300006175 Bacteria 18732
28 Ga0075430_100010168 3300006846 Bacteria 7966
29 Ga0075431_100013250 3300006847 Bacteria 8328
30 Ga0075431_100076529 3300006847 Bacteria 3453
31 Ga0075429_100110516 3300006880 Bacteria 2403
32 Ga0075429_100127148 3300006880 Bacteria 2229
33 Ga0068865_100071533 3300006881 Bacteria 2461
34 Ga0111539_10170239 3300009094 Bacteria 2545
35 Ga0105245_10036229 3300009098 Bacteria 4381
36 Ga0114129_10200446 3300009147 Bacteria 2704
37 Ga0114129_10365540 3300009147 Bacteria 1908
38 Ga0163163_10189734 3300014325 Bacteria 2104
39 Ga0206353_10743965 3300020082 Bacteria 11827
40 Ga0207692_10000158 3300025898 Bacteria 21293
41 Ga0207699_10000165 3300025906 Bacteria 40682
42 Ga0207684_10000692 3300025910 Bacteria 39839
43 Ga0207684_10054755 3300025910 Bacteria 3384
44 Ga0207693_10015901 3300025915 Bacteria 6024
45 Ga0207663_10003943 3300025916 Bacteria 7341
46 Ga0207646_10000288 3300025922 Bacteria 69433
47 Ga0207659_10065396 3300025926 Bacteria 2635
48 Ga0207700_10000487 3300025928 Bacteria 23292
49 Ga0207664_10000502 3300025929 Bacteria 27912
50 Ga0207690_10072359 3300025932 Bacteria 2381
51 Ga0207665_10000819 3300025939 Bacteria 21047
52 Ga0207708_10070084 3300026075 Bacteria 2685
53 Ga0207698_10034641 3300026142 Bacteria 3683
54 Ga0316576_10010372 3300031727 Bacteria 6052
55 Ga0316576_10168112 3300031727 Bacteria 1655
56 Ga0307405_10135728 3300031731 Bacteria 1708
57 Ga0307413_10029280 3300031824 Bacteria 3079
58 Ga0307413_10053902 3300031824 Bacteria 2437
59 Ga0307413_10077642 3300031824 Bacteria 2116
60 Ga0307410_10019736 3300031852 Bacteria 4107
61 Ga0307410_10074808 3300031852 Bacteria 2360
62 Ga0307406_10042162 3300031901 Bacteria 2848
63 Ga0307407_10031758 3300031903 Bacteria 2864
64 Ga0307412_10129250 3300031911 Bacteria 1832
65 Ga0307412_10144854 3300031911 Bacteria 1745
66 Ga0307409_100010968 3300031995 Bacteria 5677
67 Ga0307409_100060647 3300031995 Bacteria 2951
68 Ga0307409_100078345 3300031995 Bacteria 2658
69 Ga0307409_100087995 3300031995 Bacteria 2534
70 Ga0307416_100004077 3300032002 Bacteria 8734
71 Ga0307416_100025421 3300032002 Bacteria 4340
72 Ga0307416_100033268 3300032002 Bacteria 3906
73 Ga0307416_100145503 3300032002 Bacteria 2163
74 Ga0307411_10028838 3300032005 Bacteria 3380
75 Ga0307415_100022332 3300032126 Bacteria 3902
76 Ga0307415_100028422 3300032126 Bacteria 3558
77 Ga0307415_100072304 3300032126 Bacteria 2428
78 Ga0436364_1425462 3300037853 Bacteria 2064
79 Ga0436365_0467699 3300039437 Bacteria 2830
80 Ga0436365_0888870 3300039437 Bacteria 6307
81 Ga0436363_0256550 3300039450 Bacteria 7262
82 Ga0436363_0545162 3300039450 Bacteria 20641
83 Ga0436363_1314756 3300039450 Bacteria 2793
84 Ga0466966_0019803 3300044684 Bacteria 4426
85 Ga0466961_0015552 3300044693 Bacteria 4883
86 Ga0466963_0001656 3300044694 Bacteria 12144
87 Ga0466963_0017884 3300044694 Bacteria 4423
88 Ga0466963_0039336 3300044694 Bacteria 3097
89 Ga0466968_0005639 3300044735 Bacteria 4690
90 Ga0466957_0009020 3300044842 Bacteria 5685
91 Ga0466958_0009430 3300045836 Bacteria 5439
92 Ga0466958_0009934 3300045836 Bacteria 5317
93 Ga0466967_0036898 3300045976 Bacteria 4177
94 Ga0466967_0084563 3300045976 Bacteria 2871
95 Ga0466967_0192419 3300045976 Bacteria 1928
96 Ga0466967_0213835 3300045976 Bacteria 1829
97 Ga0496102_0087355 3300048905 Bacteria 2881
98 Ga0496105_0135080 3300048908 Bacteria 2032
99 Ga0496106_0089947 3300048909 Bacteria 2368
100 Ga0496111_0145073 3300048914 Bacteria 1760
101 Ga0501031_0049156 3300049568 Bacteria 2748
102 Ga0501031_0113454 3300049568 Bacteria 1770
103 Ga0501036_0026753 3300049572 Bacteria 4873
104 Ga0501036_0087455 3300049572 Bacteria 2634
105 Ga0501037_0039953 3300049573 Bacteria 3453
106 Ga0501040_0062488 3300049576 Bacteria 2562
107 Ga0501040_0095959 3300049576 Bacteria 2064
108 Ga0501041_0040435 3300049577 Bacteria 2830
109 Ga0501042_0032673 3300049578 Bacteria 3686
110 Ga0501042_0051221 3300049578 Bacteria 2945
111 Ga0501042_0069407 3300049578 Bacteria 2520
112 Ga0501043_0064173 3300049579 Bacteria 2884
113 Ga0501046_0160495 3300049580 Bacteria 1691
114 Ga0501072_0049506 3300049588 Bacteria 3308
115 Ga0501072_0101119 3300049588 Bacteria 2291
116 Ga0501072_0203989 3300049588 Bacteria 1576
117 Ga0501075_0135593 3300049591 Bacteria 1875
118 Ga0501076_0026502 3300049592 Bacteria 4491
119 Ga0501076_0143586 3300049592 Bacteria 1940
120 Ga0501077_0052163 3300049593 Bacteria 2598
121 Ga0501077_0093660 3300049593 Bacteria 1904
122 Ga0501077_0108093 3300049593 Bacteria 1762
123 Ga0501079_0074493 3300049741 Bacteria 2624
124 Ga0501080_0283874 3300049742 Bacteria 1504
125 Ga0501081_0011280 3300049743 Bacteria 5846
126 Ga0501081_0080924 3300049743 Bacteria 2274
127 Ga0501081_0091126 3300049743 Bacteria 2144
128 Ga0501035_0261713 3300049822 Bacteria 1466
129 Ga0501045_0000641 3300049824 Bacteria 22097
130 Ga0501045_0074010 3300049824 Bacteria 2509
131 nmdc:mga05p37_26088_c1 3300050507 Bacteria 7106
132 nmdc:mga09592_38200_c1 3300050508 Bacteria 4029
133 nmdc:mga0qj67_2929_c1 3300050509 Bacteria 12245
134 nmdc:mga06r32_157613_c1 3300050510 Bacteria 2252
135 nmdc:mga08y16_140898_c1 3300050511 Bacteria 2507
136 Ga0501082_0221981 3300060353 Bacteria 1644
137 Ga0530510_0128380 3300061734 Bacteria 1864
138 2623499671 2622736605 Bacteria 4992138
139 Ga0207675_100134037
140 JGI25407J50210_10002177
141 Ga0070709_10000132
142 Ga0070714_100000946
143 Ga0070713_100000962
144 Ga0070710_10000414
145 Ga0070711_100003507
146 Ga0070706_100001069
147 Ga0070706_100010230
148 Ga0070707_100000067
149 Ga0070698_100001348
150 Ga0070698_100005221
151 Ga0070664_100084211
152 Ga0068864_100133010
153 Ga0081538_10000517
154 Ga0081538_10000624
155 Ga0081538_10001326
156 Ga0081538_10005110
157 Ga0081538_10005575
158 Ga0081538_10007907
159 Ga0081538_10013662
160 Ga0081538_10066616
161 Ga0081539_10002924
162 Ga0070717_10002433
163 Ga0070717_10044145
164 Ga0070716_100000264
165 Ga0070712_100000793
166 Ga0075430_100010168
167 Ga0075431_100013250
168 Ga0075431_100076529
169 Ga0075429_100110516
170 Ga0075429_100127148
171 Ga0068865_100071533
172 Ga0111539_10170239
173 Ga0105245_10036229
174 Ga0114129_10200446
175 Ga0114129_10365540
176 Ga0163163_10189734
177 Ga0206353_10743965
178 Ga0207692_10000158
179 Ga0207699_10000165
180 Ga0207684_10000692
181 Ga0207684_10054755
182 Ga0207693_10015901
183 Ga0207663_10003943
184 Ga0207646_10000288
185 Ga0207659_10065396
186 Ga0207700_10000487
187 Ga0207664_10000502
188 Ga0207690_10072359
189 Ga0207665_10000819
190 Ga0207708_10070084
191 Ga0207698_10034641
192 Ga0316576_10010372
193 Ga0316576_10168112
194 Ga0307405_10135728
195 Ga0307413_10029280
196 Ga0307413_10053902
197 Ga0307413_10077642
198 Ga0307410_10019736
199 Ga0307410_10074808
200 Ga0307406_10042162
201 Ga0307407_10031758
202 Ga0307412_10129250
203 Ga0307412_10144854
204 Ga0307409_100010968
205 Ga0307409_100060647
206 Ga0307409_100078345
207 Ga0307409_100087995
208 Ga0307416_100004077
209 Ga0307416_100025421
210 Ga0307416_100033268
211 Ga0307416_100145503
212 Ga0307411_10028838
213 Ga0307415_100022332
214 Ga0307415_100028422
215 Ga0307415_100072304
216 Ga0436364_1425462
217 Ga0436365_0467699
218 Ga0436365_0888870
219 Ga0436363_0256550
220 Ga0436363_0545162
221 Ga0436363_1314756
222 Ga0466966_0019803
223 Ga0466961_0015552
224 Ga0466963_0001656
225 Ga0466963_0017884
226 Ga0466963_0039336
227 Ga0466968_0005639
228 Ga0466957_0009020
229 Ga0466958_0009430
230 Ga0466958_0009934
231 Ga0466967_0036898
232 Ga0466967_0084563
233 Ga0466967_0192419
234 Ga0466967_0213835
235 Ga0496102_0087355
236 Ga0496105_0135080
237 Ga0496106_0089947
238 Ga0496111_0145073
239 Ga0501031_0049156
240 Ga0501031_0113454
241 Ga0501036_0026753
242 Ga0501036_0087455
243 Ga0501037_0039953
244 Ga0501040_0062488
245 Ga0501040_0095959
246 Ga0501041_0040435
247 Ga0501042_0032673
248 Ga0501042_0051221
249 Ga0501042_0069407
250 Ga0501043_0064173
251 Ga0501046_0160495
252 Ga0501072_0049506
253 Ga0501072_0101119
254 Ga0501072_0203989
255 Ga0501075_0135593
256 Ga0501076_0026502
257 Ga0501076_0143586
258 Ga0501077_0052163
259 Ga0501077_0093660
260 Ga0501077_0108093
261 Ga0501079_0074493
262 Ga0501080_0283874
263 Ga0501081_0011280
264 Ga0501081_0080924
265 Ga0501081_0091126
266 Ga0501035_0261713
267 Ga0501045_0000641
268 Ga0501045_0074010
269 nmdc:mga05p37_26088_c1
270 nmdc:mga09592_38200_c1
271 nmdc:mga0qj67_2929_c1
272 nmdc:mga06r32_157613_c1
273 nmdc:mga08y16_140898_c1
274 Ga0501082_0221981
275 Ga0530510_0128380
276 2623499671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

69

484

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a2p-assembly1.cif.gz_A structure of 6-aminohexanoate cyclic dimer hydrolase 0.9428 6 458
3a2p-assembly1.cif.gz_A structure of 6-aminohexanoate cyclic dimer hydrolase 0.9249 6 458
3a2q-assembly1.cif.gz_A structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate 0.918 6 459
3a2q-assembly1.cif.gz_A structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate 0.9026 6 459
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.9001 5 456
ID Description Score Start End Superfamily
3a2pA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9428 6 458 3.90.1300.10
3a2pA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9249 6 458 3.90.1300.10
af_P9WQ99_18_483_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9196 7 457 3.90.1300.10
af_P9WQ97_5_462_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9113 4 458 3.90.1300.10
af_P9WQ95_12_473_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.91 8 450 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A845QBX5-F1-model_v4 Indoleacetamide hydrolase 0.9687 4 458 GO:0016787
AF-A0A7K0RHS9-F1-model_v4 Amidase domain-containing protein 0.967 1 142 GO:0012505
AF-A0A450TQ95-F1-model_v4 Amidase 0.9635 67 456 GO:0016787
AF-A0A2D7NUT2-F1-model_v4 Amidase 0.9624 12 458 GO:0016787
AF-A0A3B8MF77-F1-model_v4 Amidase 0.962 151 458 GO:0003824

Map