F173249

General Info

Members Datasets Scaffolds Average Seq Length
138 101 108 253

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1026248|Ga0209758_10262483
Length 282
Sequence MSGRPGFRAEGEGFIYGRLILLHGNRELPMSKSCVECRNGEAFTIPFSMAFQPIIDLRTDTIFAHEALVRGPTGEGAGSVLSAVDAFNRYAFDQQCRVKAIELASSLFPKDDGVGLSINFMPNAVYEPRACIRLTLAAAMRTNFPIRNIIFEFTESEQLDTAHLYNILQTYRDMGFRTAIDDFGAGHAGLGLLADFQPDIAKLDMALIRGIDTDDARQKIVKHTVAMLDDLGVTPLCEGIETVAELQALQDLGINLVQGYLIAKPSFEALAVPKFDAFRQAA

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
3 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
6 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
7 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
8 2643221568 Rhizobium sp. Root564 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
14 2643221718 Rhizobium sp. Root268 Isolate Unclassified
15 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
16 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
17 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
18 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
19 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
20 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
21 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
22 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
23 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
24 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
25 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
26 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
27 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
71 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
78 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
79 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
80 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
88 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
91 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
92 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
93 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
94 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
95 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
96 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
97 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
98 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
99 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
100 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
101 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.26
Metatranscriptomes 0
Isolates 21.74

Biome Distribution

Category Percentage (%)
Aerial Root 2.9
Bulb 0
Endosphere 32.61
Nodule 1.45
Rhizoplane 3.62
Rhizosphere 25.36
Stem 0
Stem Tuber 0
Unclassified 34.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10014007 3300003316 Bacteria 3121
2 rootH2_10190202 3300003320 Bacteria 4456
3 rootH1_10234477 3300003323 Bacteria 3316
4 Ga0055524_1000895 3300003775 Bacteria 19308
5 Ga0055528_1000083 3300003790 Bacteria 74840
6 Ga0055540_1000273 3300003792 Bacteria 46613
7 Ga0055540_1003643 3300003792 Bacteria 7336
8 Ga0055531_10000106 3300003794 Bacteria 91868
9 Ga0055531_10004263 3300003794 Bacteria 8787
10 Ga0065165_1011394 3300005262 Bacteria 3716
11 Ga0065165_1012704 3300005262 Bacteria 3409
12 Ga0070670_100002341 3300005331 Bacteria 15603
13 Ga0070670_100007113 3300005331 Bacteria 9475
14 Ga0070665_100425128 3300005548 Bacteria 1337
15 Ga0075365_10002688 3300006038 Bacteria 8847
16 Ga0075364_10000471 3300006051 Bacteria 20466
17 Ga0075370_10043579 3300006353 Bacteria 2536
18 Ga0075370_10152802 3300006353 Bacteria 1353
19 Ga0079104_1000373 3300006946 Bacteria 52808
20 Ga0105238_10107047 3300009551 Bacteria 2777
21 Ga0157373_10024385 3300013100 Bacteria 4382
22 Ga0157371_10388214 3300013102 Bacteria 1020
23 Ga0157369_10217962 3300013105 Bacteria 1998
24 Ga0157369_10229445 3300013105 Bacteria 1941
25 Ga0157369_10523626 3300013105 Bacteria 1226
26 Ga0163162_10152739 3300013306 Bacteria 2427
27 Ga0183363_1005 3300015690 Bacteria 403020
28 Ga0163161_10172159 3300017792 Bacteria 1656
29 Ga0209673_1000086 3300025273 Bacteria 210101
30 Ga0209676_1013682 3300025292 Bacteria 3104
31 Ga0209676_1017652 3300025292 Bacteria 2517
32 Ga0209676_1019449 3300025292 Bacteria 2336
33 Ga0209025_1000044 3300025294 Bacteria 349480
34 Ga0209025_1002833 3300025294 Bacteria 17434
35 Ga0209025_1064751 3300025294 Bacteria 1340
36 Ga0209564_1001360 3300025295 Bacteria 25720
37 Ga0209758_1000105 3300025297 Bacteria 221415
38 Ga0209758_1026248 3300025297 Bacteria 2528
39 Ga0209256_1002202 3300025299 Bacteria 16700
40 Ga0209051_1000192 3300025303 Bacteria 108667
41 Ga0209051_1025148 3300025303 Bacteria 2430
42 Ga0209257_1000300 3300025304 Bacteria 108786
43 Ga0209257_1017946 3300025304 Bacteria 2753
44 Ga0207694_10073627 3300025924 Bacteria 2673
45 Ga0207650_10000745 3300025925 Bacteria 25118
46 Ga0207650_10044002 3300025925 Bacteria 3280
47 Ga0209281_1000108 3300027111 Bacteria 217582
48 Ga0268266_10375224 3300028379 Bacteria 1340
49 Ga0307515_10003836 3300028794 Bacteria 31431
50 Ga0265327_10001007 3300031251 Bacteria 40000
51 Ga0307513_10001789 3300031456 Bacteria 30534
52 Ga0395905_0000821 3300037471 Bacteria 40750
53 Ga0436364_0868450 3300037853 Bacteria 1666
54 Ga0436365_0474911 3300039437 Bacteria 1341
55 Ga0436365_1106758 3300039437 Bacteria 2085
56 Ga0495596_0009393 3300046500 Bacteria 4303
57 Ga0495610_0006558 3300046512 Bacteria 7966
58 Ga0495610_0017566 3300046512 Bacteria 4075
59 Ga0495610_0055461 3300046512 Bacteria 1910
60 Ga0495632_0069778 3300046519 Bacteria 1691
61 Ga0495648_0029152 3300046524 Bacteria 3667
62 Ga0495654_0181806 3300046530 Bacteria 910
63 Ga0495625_0172169 3300046660 Bacteria 1445
64 Ga0495626_0001016 3300048091 Bacteria 24136
65 Ga0496116_0000142 3300048919 Bacteria 150342
66 Ga0496117_0003151 3300048920 Bacteria 19665
67 Ga0496117_0016613 3300048920 Bacteria 6198
68 Ga0496117_0188273 3300048920 Bacteria 1179
69 Ga0496118_0070468 3300048921 Bacteria 2524
70 Ga0496121_0000115 3300048924 Bacteria 178411
71 Ga0496121_0139013 3300048924 Bacteria 1805
72 Ga0496122_0000107 3300048925 Bacteria 193163
73 Ga0496122_0002543 3300048925 Bacteria 25659
74 Ga0496122_0025859 3300048925 Bacteria 5082
75 Ga0496123_0000063 3300048926 Bacteria 216072
76 Ga0496123_0057466 3300048926 Bacteria 2532
77 Ga0496123_0135796 3300048926 Bacteria 1354
78 Ga0496124_0000072 3300048927 Bacteria 219914
79 Ga0496124_0000428 3300048927 Bacteria 75094
80 Ga0496124_0017563 3300048927 Bacteria 6739
81 Ga0496124_0130599 3300048927 Bacteria 1996
82 Ga0496124_0230545 3300048927 Bacteria 1385
83 Ga0496124_0237767 3300048927 Bacteria 1357
84 Ga0496126_0129314 3300048929 Bacteria 2184
85 Ga0496126_0177670 3300048929 Bacteria 1810
86 Ga0501033_0027179 3300049570 Bacteria 4303
87 Ga0501034_0645805 3300049571 Bacteria 960
88 Ga0501080_0091764 3300049742 Bacteria 2821
89 Ga0501241_000978 3300049758 Bacteria 6015
90 Ga0501035_0001059 3300049822 Bacteria 28829
91 nmdc:mga00v17_221_c1 3300050491 Bacteria 34258
92 nmdc:mga0yw44_1879_c1 3300050492 Bacteria 8643
93 nmdc:mga07m45_5252_c1 3300050496 Bacteria 6431
94 Ga0500643_002643 3300053087 Bacteria 9058
95 Ga0500643_030155 3300053087 Bacteria 1663
96 Ga0500556_0026622 3300053104 Bacteria 1923
97 Ga0500562_045402 3300053108 Bacteria 1171
98 Ga0500607_001183 3300053121 Bacteria 24020
99 Ga0500608_048061 3300053122 Bacteria 2050
100 Ga0500618_000478 3300053125 Bacteria 25756
101 Ga0500559_0001465 3300053136 Bacteria 13356
102 Ga0500559_0016583 3300053136 Bacteria 3112
103 Ga0500559_0221677 3300053136 Bacteria 892
104 Ga0500573_0000100 3300053140 Bacteria 37372
105 Ga0500573_0005135 3300053140 Bacteria 6983
106 Ga0500573_0014138 3300053140 Bacteria 4510
107 Ga0500604_0010547 3300053151 Bacteria 2474
108 Ga0500636_0000005 3300053177 Bacteria 197561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015690 Ga0183363_1005 Ga0183363_1005198 218
2 3300048924 Ga0496121_0139013 Ga0496121_0139013_465_1148 227
3 3300048927 Ga0496124_0237767 Ga0496124_0237767_24_719 231
4 3300048929 Ga0496126_0129314 Ga0496126_0129314_644_1348 234
5 3300049758 Ga0501241_000978 Ga0501241_000978_377_1081 234
6 3300013306 Ga0163162_10152739 Ga0163162_101527392 235
7 3300037471 Ga0395905_0000821 Ga0395905_0000821_21736_22443 235
8 3300006353 Ga0075370_10043579 Ga0075370_100435792 236
9 3300048920 Ga0496117_0188273 Ga0496117_0188273_20_730 236
10 3300053136 Ga0500559_0016583 Ga0500559_0016583_1585_2301 236
11 3300053177 Ga0500636_0000005 Ga0500636_0000005_73398_74108 236
12 iso_pu_bacteria 8018150411 8018152094 243
13 3300013105 Ga0157369_10217962 Ga0157369_102179621 245
14 iso_pu_bacteria 2510917026 2511173675 245
15 iso_pu_bacteria 2919171160 2919173506 245
16 iso_pu_bacteria 2558860983 2561468039 246
17 iso_pu_bacteria 2565956521 2566036585 246
18 3300049570 Ga0501033_0027179 Ga0501033_0027179_1419_2165 248
19 3300049822 Ga0501035_0001059 Ga0501035_0001059_14227_14973 248
20 3300003792 Ga0055540_1003643 Ga0055540_10036435 249
21 3300003794 Ga0055531_10004263 Ga0055531_100042636 249
22 3300025292 Ga0209676_1019449 Ga0209676_10194492 249
23 3300025297 Ga0209758_1000105 Ga0209758_100010516 249
24 3300025303 Ga0209051_1025148 Ga0209051_10251482 249
25 3300025304 Ga0209257_1017946 Ga0209257_10179462 249
26 iso_pu_bacteria 2599185156 2599332402 249
27 iso_pu_bacteria 2600254933 2600377252 249
28 iso_pu_bacteria 2842922631 2842922670 249
29 3300005262 Ga0065165_1012704 Ga0065165_10127041 250
30 3300005331 Ga0070670_100007113 Ga0070670_1000071138 250
31 3300005548 Ga0070665_100425128 Ga0070665_1004251282 250
32 3300025925 Ga0207650_10000745 Ga0207650_100007452 250
33 3300028379 Ga0268266_10375224 Ga0268266_103752242 250
34 3300048925 Ga0496122_0000107 Ga0496122_0000107_89408_90166 250
35 3300048926 Ga0496123_0000063 Ga0496123_0000063_102943_103701 250
36 iso_pu_bacteria 2643221637 2644208460 250
37 iso_pu_bacteria 2643221718 2644651712 250
38 iso_pu_bacteria 2894817345 2894818023 250
39 iso_pu_bacteria 2928027323 2928029806 250
40 iso_pu_bacteria 2984555340 2984557594 250
41 iso_pu_bacteria 2984564862 2984568041 250
42 iso_pu_bacteria 2993356040 2993359088 250
43 3300006038 Ga0075365_10002688 Ga0075365_1000268812 251
44 3300006051 Ga0075364_10000471 Ga0075364_1000047112 251
45 3300025294 Ga0209025_1000044 Ga0209025_1000044270 251
46 3300048920 Ga0496117_0003151 Ga0496117_0003151_2242_2997 251
47 3300048924 Ga0496121_0000115 Ga0496121_0000115_170894_171649 251
48 3300050491 nmdc:mga00v17_221_c1 nmdc:mga00v17_221_c1_21863_22618 251
49 3300050492 nmdc:mga0yw44_1879_c1 nmdc:mga0yw44_1879_c1_2404_3159 251
50 iso_pu_bacteria 2600254933 2600377203 251
51 iso_pu_bacteria 2643221568 2643856789 251
52 iso_pu_bacteria 2643221614 2644088017 251
53 iso_pu_bacteria 2643221661 2644344096 251
54 iso_pu_bacteria 2643221666 2644367374 251
55 iso_pu_bacteria 2643221689 2644500890 251
56 iso_pu_bacteria 2738541317 2738948211 251
57 iso_pu_bacteria 2913308742 2913313125 251
58 iso_pu_bacteria 2919166419 2919169224 251
59 iso_pu_bacteria 2978969890 2978974599 251
60 iso_pu_bacteria 2984587000 2984589921 251
61 iso_pu_bacteria 8054460903 8054464085 251
62 3300046660 Ga0495625_0172169 Ga0495625_0172169_100_858 252
63 iso_pu_bacteria 2574179768 2574431072 252
64 3300003792 Ga0055540_1000273 Ga0055540_100027352 253
65 3300003794 Ga0055531_10000106 Ga0055531_100001064 253
66 3300005331 Ga0070670_100002341 Ga0070670_1000023415 253
67 3300025292 Ga0209676_1017652 Ga0209676_10176521 253
68 3300025297 Ga0209758_1026248 Ga0209758_10262483 253
69 3300025303 Ga0209051_1000192 Ga0209051_1000192113 253
70 3300025304 Ga0209257_1000300 Ga0209257_10003004 253
71 3300025925 Ga0207650_10044002 Ga0207650_100440022 253
72 3300048927 Ga0496124_0017563 Ga0496124_0017563_2078_2839 253
73 3300048929 Ga0496126_0177670 Ga0496126_0177670_143_904 253
74 3300053087 Ga0500643_002643 Ga0500643_002643_4879_5643 253
75 3300037853 Ga0436364_0868450 Ga0436364_0868450_450_1235 254
76 3300039437 Ga0436365_0474911 Ga0436365_0474911_73_858 254
77 3300046500 Ga0495596_0009393 Ga0495596_0009393_2809_3576 254
78 3300046512 Ga0495610_0006558 Ga0495610_0006558_2479_3246 254
79 3300048091 Ga0495626_0001016 Ga0495626_0001016_5577_6344 254
80 3300050496 nmdc:mga07m45_5252_c1 nmdc:mga07m45_5252_c1_503_1285 254
81 3300053108 Ga0500562_045402 Ga0500562_045402_230_1000 254
82 3300053121 Ga0500607_001183 Ga0500607_001183_11134_11916 254
83 3300053136 Ga0500559_0001465 Ga0500559_0001465_473_1255 254
84 3300053140 Ga0500573_0005135 Ga0500573_0005135_5000_5764 254
85 3300053140 Ga0500573_0014138 Ga0500573_0014138_529_1293 254
86 3300053151 Ga0500604_0010547 Ga0500604_0010547_240_1010 254
87 iso_pu_bacteria 2751185897 2753765183 254
88 3300003316 rootH1_10014007 rootH1_100140072 255
89 3300003320 rootH2_10190202 rootH2_101902022 255
90 3300003323 rootH1_10234477 rootH1_102344772 255
91 3300003775 Ga0055524_1000895 Ga0055524_10008955 255
92 3300003790 Ga0055528_1000083 Ga0055528_100008323 255
93 3300005262 Ga0065165_1011394 Ga0065165_10113946 255
94 3300006353 Ga0075370_10152802 Ga0075370_101528021 255
95 3300006946 Ga0079104_1000373 Ga0079104_100037313 255
96 3300009551 Ga0105238_10107047 Ga0105238_101070472 255
97 3300013100 Ga0157373_10024385 Ga0157373_100243854 255
98 3300013102 Ga0157371_10388214 Ga0157371_103882142 255
99 3300013105 Ga0157369_10229445 Ga0157369_102294452 255
100 3300013105 Ga0157369_10523626 Ga0157369_105236261 255
101 3300017792 Ga0163161_10172159 Ga0163161_101721592 255
102 3300025273 Ga0209673_1000086 Ga0209673_1000086192 255
103 3300025292 Ga0209676_1013682 Ga0209676_10136823 255
104 3300025294 Ga0209025_1002833 Ga0209025_100283313 255
105 3300025294 Ga0209025_1064751 Ga0209025_10647512 255
106 3300025295 Ga0209564_1001360 Ga0209564_10013605 255
107 3300025299 Ga0209256_1002202 Ga0209256_10022028 255
108 3300025924 Ga0207694_10073627 Ga0207694_100736273 255
109 3300027111 Ga0209281_1000108 Ga0209281_1000108209 255
110 3300028794 Ga0307515_10003836 Ga0307515_1000383618 255
111 3300031251 Ga0265327_10001007 Ga0265327_1000100721 255
112 3300031456 Ga0307513_10001789 Ga0307513_1000178915 255
113 3300039437 Ga0436365_1106758 Ga0436365_1106758_851_1636 255
114 3300046512 Ga0495610_0017566 Ga0495610_0017566_2344_3111 255
115 3300046512 Ga0495610_0055461 Ga0495610_0055461_1075_1842 255
116 3300046519 Ga0495632_0069778 Ga0495632_0069778_479_1246 255
117 3300046524 Ga0495648_0029152 Ga0495648_0029152_2172_2957 255
118 3300046530 Ga0495654_0181806 Ga0495654_0181806_11_778 255
119 3300048919 Ga0496116_0000142 Ga0496116_0000142_116145_116912 255
120 3300048920 Ga0496117_0016613 Ga0496117_0016613_4236_5024 255
121 3300048921 Ga0496118_0070468 Ga0496118_0070468_1445_2233 255
122 3300048925 Ga0496122_0002543 Ga0496122_0002543_4310_5077 255
123 3300048925 Ga0496122_0025859 Ga0496122_0025859_1242_2009 255
124 3300048926 Ga0496123_0057466 Ga0496123_0057466_1431_2198 255
125 3300048926 Ga0496123_0135796 Ga0496123_0135796_101_889 255
126 3300048927 Ga0496124_0000072 Ga0496124_0000072_175384_176172 255
127 3300048927 Ga0496124_0000428 Ga0496124_0000428_67669_68448 255
128 3300048927 Ga0496124_0130599 Ga0496124_0130599_184_951 255
129 3300048927 Ga0496124_0230545 Ga0496124_0230545_354_1121 255
130 3300049571 Ga0501034_0645805 Ga0501034_0645805_44_814 255
131 3300049742 Ga0501080_0091764 Ga0501080_0091764_1109_1879 255
132 3300053087 Ga0500643_030155 Ga0500643_030155_111_890 255
133 3300053104 Ga0500556_0026622 Ga0500556_0026622_489_1256 255
134 3300053122 Ga0500608_048061 Ga0500608_048061_517_1287 255
135 3300053125 Ga0500618_000478 Ga0500618_000478_17158_17925 255
136 3300053136 Ga0500559_0221677 Ga0500559_0221677_45_854 255
137 3300053140 Ga0500573_0000100 Ga0500573_0000100_16533_17312 255
138 iso_pu_bacteria 2599185354 2600200784 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00563

EAL

EAL domain

44

265

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifq-assembly1.cif.gz_A crystal structure of a standalone versatile eal protein from vibrio cholerae o395 - apo form 0.9544 13 245
3gg0-assembly1.cif.gz_B klebsiella pneumoniae blrp1 ph 9.0 manganese/cy-digmp complex 0.9343 17 244
3gg0-assembly1.cif.gz_A klebsiella pneumoniae blrp1 ph 9.0 manganese/cy-digmp complex 0.9333 14 239
6ifq-assembly1.cif.gz_A crystal structure of a standalone versatile eal protein from vibrio cholerae o395 - apo form 0.9271 13 245
3gfy-assembly1.cif.gz_B klebsiella pneumoniae blrp1 with fmn and cyclic digmp, no metal ions 0.9256 15 241
ID Description Score Start End Superfamily
3gg0B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.9343 17 244 3.20.20.450
af_P75990_172_403_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.9213 20 245 3.20.20.450
af_P9WM13_355_611_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.898 18 235 3.20.20.450
af_P32701_269_524_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.893 18 239 3.20.20.450
af_P75990_172_403_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.8907 20 245 3.20.20.450
ID Description Score Start End GO Terms
AF-A0A3M7LK96-F1-model_v4 deleted 0.9765 122 225
AF-A0A259C287-F1-model_v4 Diguanylate phosphodiesterase 0.9753 39 245 GO:0071111
AF-A0A1D3RP06-F1-model_v4 Diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(S) 0.9693 136 235 GO:0071111
AF-A0A6H2HDL1-F1-model_v4 Blue light-and temperature-regulated antirepressor BluF 0.9558 4 242 GO:0071111
AF-B7DP82-F1-model_v4 deleted 0.9546 106 231

Feature Viewer

pLDDT pTM Quality
88.98 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map