F172997

General Info

Members Datasets Scaffolds Average Seq Length
138 86 138 286

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10441610|Ga0105242_104416102
Length 316
Sequence MALSAGSPDPAPADYDALDIELSVPQNERDVGIAGHTAWITGAGGLIGNYLVQTAPTFASGWRVVGLIRAQLELTDFSVVRAAFTSQRPQLLIHCAALSQSPVCQANPALARQLNVEVTRYLAELASGIPLIFFSSDLVFDGRKGNYVESDPVNPLSVYAETKVAAEQIVLRNPQHTVVRTSLNGGVSPTGERGFNEELRRAWQAGKTINLFTDEFRSPIPAKVTARGVWELVAKNQPGLYHLAGSERLSRWQIGQLIAGRWPQLNPRIDPGSLKDYQGAPRPPDTSLNCGRIQKLLSFSLPGLTEWLKANPDERF

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
47 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
53 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
86 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10378089 3300003323 Unclassified 1770
2 Ga0070690_100157640 3300005330 Bacteria 1553
3 Ga0070689_100016558 3300005340 Bacteria 5396
4 Ga0070689_100108584 3300005340 Bacteria 2204
5 Ga0070689_100246401 3300005340 Bacteria 1473
6 Ga0070667_100334660 3300005367 Bacteria 1368
7 Ga0070708_100085383 3300005445 Bacteria 2865
8 Ga0070681_10049083 3300005458 Bacteria 4216
9 Ga0070686_100257090 3300005544 Bacteria 1278
10 Ga0068856_100141114 3300005614 Bacteria 2416
11 Ga0068859_100169959 3300005617 Bacteria 2261
12 Ga0068859_100361427 3300005617 Unclassified 1547
13 Ga0068864_100052269 3300005618 Bacteria 3521
14 Ga0068861_100452938 3300005719 Unclassified 1150
15 Ga0068851_10223284 3300005834 Unclassified 1059
16 Ga0068863_100237558 3300005841 Bacteria 1759
17 Ga0068863_100717771 3300005841 Bacteria 994
18 Ga0068858_100155700 3300005842 Bacteria 2150
19 Ga0081455_10125503 3300005937 Bacteria 2015
20 Ga0081455_10288444 3300005937 Bacteria 1182
21 Ga0097621_100105112 3300006237 Bacteria 2380
22 Ga0068871_100040644 3300006358 Bacteria 3726
23 Ga0075428_100000842 3300006844 Bacteria 32151
24 Ga0075431_100190044 3300006847 Bacteria 2104
25 Ga0075434_100077012 3300006871 Unclassified 3330
26 Ga0075434_100341100 3300006871 Bacteria 1519
27 Ga0097620_100169963 3300006931 Bacteria 2261
28 Ga0097620_100361460 3300006931 Unclassified 1547
29 Ga0105240_10008477 3300009093 Bacteria 14699
30 Ga0105240_10092518 3300009093 Bacteria 3692
31 Ga0105240_10201236 3300009093 Unclassified 2334
32 Ga0105240_10258965 3300009093 Unclassified 2008
33 Ga0105245_10277369 3300009098 Bacteria 1637
34 Ga0105241_10214039 3300009174 Bacteria 1616
35 Ga0105242_10027078 3300009176 Unclassified 4548
36 Ga0105242_10172922 3300009176 Unclassified 1899
37 Ga0105242_10441610 3300009176 Bacteria 1224
38 Ga0105248_10195454 3300009177 Bacteria 2279
39 Ga0105238_10001693 3300009551 Bacteria 22183
40 Ga0105238_10728448 3300009551 Unclassified 1005
41 Ga0105249_10615534 3300009553 Unclassified 1141
42 Ga0157369_10623575 3300013105 Bacteria 1113
43 Ga0163162_10600371 3300013306 Bacteria 1227
44 Ga0157372_10238713 3300013307 Unclassified 2109
45 Ga0157375_10573141 3300013308 Unclassified 1289
46 Ga0163163_10086582 3300014325 Bacteria 3142
47 Ga0207707_10491874 3300025912 Unclassified 1047
48 Ga0207695_10034017 3300025913 Bacteria 5549
49 Ga0207662_10130132 3300025918 Bacteria 1586
50 Ga0207670_10008253 3300025936 Bacteria 5867
51 Ga0207670_10011204 3300025936 Bacteria 5196
52 Ga0207670_10213210 3300025936 Bacteria 1474
53 Ga0207704_10269386 3300025938 Bacteria 1288
54 Ga0207711_10173954 3300025941 Bacteria 1955
55 Ga0207658_10330457 3300025986 Bacteria 1322
56 Ga0207641_10167441 3300026088 Bacteria 2003
57 Ga0207676_10022671 3300026095 Bacteria 4620
58 Ga0265338_10001031 3300028800 Bacteria 46585
59 Ga0265338_10027196 3300028800 Bacteria 5745
60 Ga0265338_10082530 3300028800 Bacteria 2691
61 Ga0265338_10082620 3300028800 Bacteria 2689
62 Ga0265332_10012938 3300031238 Bacteria 3700
63 Ga0265320_10100325 3300031240 Unclassified 1334
64 Ga0265320_10104673 3300031240 Unclassified 1301
65 Ga0265329_10001827 3300031242 Bacteria 10112
66 Ga0265314_10000876 3300031711 Bacteria 35825
67 Ga0265314_10074472 3300031711 Bacteria 2261
68 Ga0307406_10112181 3300031901 Bacteria 1880
69 Ga0307409_100132618 3300031995 Bacteria 2132
70 Ga0307416_100195237 3300032002 Unclassified 1914
71 Ga0307411_10066567 3300032005 Unclassified 2421
72 Ga0373954_0128784 3300035118 Unclassified 1231
73 Ga0373956_0005483 3300035119 Bacteria 5079
74 Ga0373935_0001894 3300035692 Bacteria 11754
75 Ga0373927_0018073 3300035695 Bacteria 4637
76 Ga0373947_0149884 3300035725 Bacteria 1501
77 Ga0373947_0419934 3300035725 Unclassified 904
78 Ga0373937_0155274 3300036401 Bacteria 2144
79 Ga0373937_0305663 3300036401 Bacteria 1504
80 Ga0373937_0505887 3300036401 Unclassified 1148
81 Ga0373925_0000755 3300037068 Bacteria 29746
82 Ga0373925_0204667 3300037068 Bacteria 1571
83 Ga0395905_0040227 3300037471 Bacteria 4385
84 Ga0451577_0011609 3300042876 Bacteria 8322
85 Ga0451577_0015605 3300042876 Bacteria 7058
86 Ga0451577_0023301 3300042876 Bacteria 5647
87 Ga0453684_0000255 3300044712 Bacteria 229708
88 Ga0453684_0020376 3300044712 Bacteria 10007
89 Ga0453684_0034932 3300044712 Bacteria 6962
90 Ga0453684_0299896 3300044712 Bacteria 1827
91 Ga0453684_0500309 3300044712 Unclassified 1346
92 Ga0451576_0008606 3300045051 Bacteria 11956
93 Ga0451576_0056802 3300045051 Unclassified 4093
94 Ga0451576_0076538 3300045051 Unclassified 3482
95 Ga0451576_0212061 3300045051 Unclassified 2022
96 Ga0451576_0256350 3300045051 Bacteria 1828
97 Ga0451576_0366651 3300045051 Bacteria 1509
98 Ga0495592_0000098 3300046454 Bacteria 77430
99 Ga0495592_0015043 3300046454 Bacteria 5876
100 Ga0495629_0123106 3300046459 Bacteria 1807
101 Ga0495664_0007207 3300046477 Bacteria 6167
102 Ga0495608_0296174 3300046511 Bacteria 1002
103 Ga0495618_0121171 3300046514 Bacteria 1675
104 Ga0495628_0001641 3300046516 Bacteria 20495
105 Ga0495628_0104664 3300046516 Bacteria 2181
106 Ga0495628_0289983 3300046516 Bacteria 1213
107 Ga0495628_0306224 3300046516 Unclassified 1175
108 Ga0495630_0000067 3300046517 Bacteria 84296
109 Ga0495630_0029542 3300046517 Unclassified 4075
110 Ga0495630_0131765 3300046517 Bacteria 1899
111 Ga0495630_0140679 3300046517 Bacteria 1835
112 Ga0495630_0384849 3300046517 Bacteria 1074
113 Ga0495652_0071181 3300046529 Bacteria 2904
114 Ga0495586_0000028 3300046535 Bacteria 97992
115 Ga0495586_0001009 3300046535 Bacteria 15885
116 Ga0495586_0025122 3300046535 Bacteria 3187
117 Ga0495634_0011396 3300046642 Bacteria 6477
118 Ga0495634_0160780 3300046642 Bacteria 1416
119 Ga0495599_0013122 3300046678 Bacteria 5119
120 Ga0495624_0034920 3300046690 Bacteria 3249
121 Ga0495581_0099785 3300047315 Bacteria 1687
122 Ga0495674_0003427 3300047319 Bacteria 15412
123 Ga0495674_0003764 3300047319 Bacteria 14750
124 Ga0495674_0022194 3300047319 Bacteria 5855
125 Ga0495676_0066433 3300047321 Bacteria 2795
126 Ga0495676_0155015 3300047321 Bacteria 1626
127 Ga0495684_0016178 3300047471 Bacteria 5744
128 Ga0496115_0023021 3300048918 Bacteria 4832
129 Ga0501033_0045378 3300049570 Bacteria 3271
130 Ga0501034_0244415 3300049571 Bacteria 1740
131 nmdc:mga05p37_662039_c1 3300050507 Bacteria 1167
132 nmdc:mga06r32_82431_c1 3300050510 Bacteria 3133
133 nmdc:mga08y16_201525_c1 3300050511 Bacteria 2062
134 nmdc:mga08y16_214838_c1 3300050511 Unclassified 1991
135 nmdc:mga08y16_363204_c1 3300050511 Bacteria 1486
136 nmdc:mga08y16_504849_c1 3300050511 Bacteria 1228
137 nmdc:mga0n895_543081_c1 3300050512 Bacteria 1168
138 Ga0495619_0181368 3300053085 Bacteria 1457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0023021 Ga0496115_0023021_39_905 265
2 3300025936 Ga0207670_10011204 Ga0207670_100112043 266
3 3300050510 nmdc:mga06r32_82431_c1 nmdc:mga06r32_82431_c1_1180_1986 267
4 3300053085 Ga0495619_0181368 Ga0495619_0181368_579_1385 268
5 3300046516 Ga0495628_0306224 Ga0495628_0306224_13_828 271
6 3300037068 Ga0373925_0204667 Ga0373925_0204667_727_1557 276
7 3300046459 Ga0495629_0123106 Ga0495629_0123106_276_1106 276
8 3300046514 Ga0495618_0121171 Ga0495618_0121171_688_1518 276
9 3300046517 Ga0495630_0000067 Ga0495630_0000067_52456_53286 276
10 3300046535 Ga0495586_0000028 Ga0495586_0000028_66166_66996 276
11 3300046642 Ga0495634_0011396 Ga0495634_0011396_1810_2640 276
12 3300047319 Ga0495674_0003427 Ga0495674_0003427_4708_5538 276
13 3300047321 Ga0495676_0066433 Ga0495676_0066433_276_1106 276
14 3300005340 Ga0070689_100246401 Ga0070689_1002464012 277
15 3300028800 Ga0265338_10027196 Ga0265338_100271964 278
16 3300035692 Ga0373935_0001894 Ga0373935_0001894_5404_6240 278
17 3300035695 Ga0373927_0018073 Ga0373927_0018073_741_1577 278
18 3300035725 Ga0373947_0149884 Ga0373947_0149884_158_994 278
19 3300037068 Ga0373925_0000755 Ga0373925_0000755_12637_13473 278
20 3300046517 Ga0495630_0029542 Ga0495630_0029542_3022_3858 278
21 3300047315 Ga0495581_0099785 Ga0495581_0099785_721_1557 278
22 3300047321 Ga0495676_0155015 Ga0495676_0155015_207_1043 278
23 3300006844 Ga0075428_100000842 Ga0075428_1000008425 279
24 3300025918 Ga0207662_10130132 Ga0207662_101301322 279
25 3300037471 Ga0395905_0040227 Ga0395905_0040227_506_1348 279
26 3300050511 nmdc:mga08y16_201525_c1 nmdc:mga08y16_201525_c1_1100_1939 279
27 3300028800 Ga0265338_10001031 Ga0265338_1000103133 280
28 3300005458 Ga0070681_10049083 Ga0070681_100490832 281
29 3300005614 Ga0068856_100141114 Ga0068856_1001411143 281
30 3300009093 Ga0105240_10092518 Ga0105240_100925185 281
31 3300009093 Ga0105240_10258965 Ga0105240_102589652 281
32 3300009176 Ga0105242_10172922 Ga0105242_101729222 281
33 3300009551 Ga0105238_10001693 Ga0105238_100016936 281
34 3300045051 Ga0451576_0212061 Ga0451576_0212061_126_971 281
35 3300005618 Ga0068864_100052269 Ga0068864_1000522692 282
36 3300005841 Ga0068863_100717771 Ga0068863_1007177712 282
37 3300026088 Ga0207641_10167441 Ga0207641_101674412 282
38 3300031238 Ga0265332_10012938 Ga0265332_100129382 282
39 3300031240 Ga0265320_10104673 Ga0265320_101046732 282
40 3300031242 Ga0265329_10001827 Ga0265329_100018278 282
41 3300031711 Ga0265314_10000876 Ga0265314_100008769 282
42 3300042876 Ga0451577_0023301 Ga0451577_0023301_1862_2752 282
43 3300044712 Ga0453684_0500309 Ga0453684_0500309_416_1264 282
44 3300045051 Ga0451576_0008606 Ga0451576_0008606_1871_2719 282
45 3300045051 Ga0451576_0256350 Ga0451576_0256350_594_1442 282
46 3300046511 Ga0495608_0296174 Ga0495608_0296174_14_865 282
47 3300046516 Ga0495628_0104664 Ga0495628_0104664_896_1747 282
48 3300046517 Ga0495630_0131765 Ga0495630_0131765_140_1018 282
49 3300005340 Ga0070689_100016558 Ga0070689_1000165583 283
50 3300005340 Ga0070689_100108584 Ga0070689_1001085842 283
51 3300005367 Ga0070667_100334660 Ga0070667_1003346602 283
52 3300005617 Ga0068859_100169959 Ga0068859_1001699592 283
53 3300005834 Ga0068851_10223284 Ga0068851_102232842 283
54 3300005842 Ga0068858_100155700 Ga0068858_1001557003 283
55 3300006931 Ga0097620_100169963 Ga0097620_1001699632 283
56 3300009093 Ga0105240_10008477 Ga0105240_1000847711 283
57 3300009551 Ga0105238_10728448 Ga0105238_107284481 283
58 3300013105 Ga0157369_10623575 Ga0157369_106235751 283
59 3300013308 Ga0157375_10573141 Ga0157375_105731411 283
60 3300025913 Ga0207695_10034017 Ga0207695_100340175 283
61 3300025936 Ga0207670_10008253 Ga0207670_100082533 283
62 3300025986 Ga0207658_10330457 Ga0207658_103304572 283
63 3300044712 Ga0453684_0034932 Ga0453684_0034932_890_1777 283
64 3300049570 Ga0501033_0045378 Ga0501033_0045378_768_1631 283
65 3300049571 Ga0501034_0244415 Ga0501034_0244415_90_1019 283
66 3300050511 nmdc:mga08y16_214838_c1 nmdc:mga08y16_214838_c1_208_1059 283
67 3300005445 Ga0070708_100085383 Ga0070708_1000853834 284
68 3300005617 Ga0068859_100361427 Ga0068859_1003614272 284
69 3300005719 Ga0068861_100452938 Ga0068861_1004529382 284
70 3300005841 Ga0068863_100237558 Ga0068863_1002375582 284
71 3300005937 Ga0081455_10288444 Ga0081455_102884442 284
72 3300006847 Ga0075431_100190044 Ga0075431_1001900442 284
73 3300006871 Ga0075434_100077012 Ga0075434_1000770124 284
74 3300006931 Ga0097620_100361460 Ga0097620_1003614602 284
75 3300009174 Ga0105241_10214039 Ga0105241_102140392 284
76 3300009176 Ga0105242_10027078 Ga0105242_100270781 284
77 3300009176 Ga0105242_10441610 Ga0105242_104416102 284
78 3300009177 Ga0105248_10195454 Ga0105248_101954543 284
79 3300009553 Ga0105249_10615534 Ga0105249_106155342 284
80 3300013306 Ga0163162_10600371 Ga0163162_106003712 284
81 3300013307 Ga0157372_10238713 Ga0157372_102387132 284
82 3300014325 Ga0163163_10086582 Ga0163163_100865822 284
83 3300025912 Ga0207707_10491874 Ga0207707_104918741 284
84 3300025936 Ga0207670_10213210 Ga0207670_102132102 284
85 3300025941 Ga0207711_10173954 Ga0207711_101739542 284
86 3300026095 Ga0207676_10022671 Ga0207676_100226712 284
87 3300028800 Ga0265338_10082530 Ga0265338_100825302 284
88 3300028800 Ga0265338_10082620 Ga0265338_100826202 284
89 3300031240 Ga0265320_10100325 Ga0265320_101003252 284
90 3300031711 Ga0265314_10074472 Ga0265314_100744723 284
91 3300031901 Ga0307406_10112181 Ga0307406_101121812 284
92 3300031995 Ga0307409_100132618 Ga0307409_1001326182 284
93 3300032002 Ga0307416_100195237 Ga0307416_1001952372 284
94 3300032005 Ga0307411_10066567 Ga0307411_100665671 284
95 3300035118 Ga0373954_0128784 Ga0373954_0128784_188_1042 284
96 3300035119 Ga0373956_0005483 Ga0373956_0005483_1384_2238 284
97 3300035725 Ga0373947_0419934 Ga0373947_0419934_27_881 284
98 3300036401 Ga0373937_0155274 Ga0373937_0155274_117_971 284
99 3300036401 Ga0373937_0305663 Ga0373937_0305663_427_1287 284
100 3300036401 Ga0373937_0505887 Ga0373937_0505887_21_875 284
101 3300042876 Ga0451577_0015605 Ga0451577_0015605_1411_2265 284
102 3300044712 Ga0453684_0020376 Ga0453684_0020376_1302_2156 284
103 3300044712 Ga0453684_0299896 Ga0453684_0299896_470_1330 284
104 3300045051 Ga0451576_0056802 Ga0451576_0056802_2978_3850 284
105 3300046454 Ga0495592_0000098 Ga0495592_0000098_74045_74899 284
106 3300046454 Ga0495592_0015043 Ga0495592_0015043_627_1481 284
107 3300046477 Ga0495664_0007207 Ga0495664_0007207_1640_2494 284
108 3300046516 Ga0495628_0001641 Ga0495628_0001641_8392_9246 284
109 3300046516 Ga0495628_0289983 Ga0495628_0289983_157_1011 284
110 3300046517 Ga0495630_0140679 Ga0495630_0140679_587_1450 284
111 3300046517 Ga0495630_0384849 Ga0495630_0384849_18_872 284
112 3300046529 Ga0495652_0071181 Ga0495652_0071181_335_1189 284
113 3300046535 Ga0495586_0001009 Ga0495586_0001009_5894_6748 284
114 3300046535 Ga0495586_0025122 Ga0495586_0025122_1724_2581 284
115 3300046642 Ga0495634_0160780 Ga0495634_0160780_294_1148 284
116 3300046678 Ga0495599_0013122 Ga0495599_0013122_1852_2706 284
117 3300046690 Ga0495624_0034920 Ga0495624_0034920_1982_2836 284
118 3300047319 Ga0495674_0003764 Ga0495674_0003764_3539_4393 284
119 3300047319 Ga0495674_0022194 Ga0495674_0022194_2429_3283 284
120 3300047471 Ga0495684_0016178 Ga0495684_0016178_2778_3632 284
121 3300050507 nmdc:mga05p37_662039_c1 nmdc:mga05p37_662039_c1_138_1007 284
122 3300050511 nmdc:mga08y16_363204_c1 nmdc:mga08y16_363204_c1_206_1060 284
123 3300050511 nmdc:mga08y16_504849_c1 nmdc:mga08y16_504849_c1_349_1212 284
124 3300050512 nmdc:mga0n895_543081_c1 nmdc:mga0n895_543081_c1_255_1127 284
125 3300005330 Ga0070690_100157640 Ga0070690_1001576401 285
126 3300045051 Ga0451576_0076538 Ga0451576_0076538_2483_3343 285
127 3300005544 Ga0070686_100257090 Ga0070686_1002570901 286
128 3300006237 Ga0097621_100105112 Ga0097621_1001051122 286
129 3300006871 Ga0075434_100341100 Ga0075434_1003411002 286
130 3300005937 Ga0081455_10125503 Ga0081455_101255032 288
131 3300006358 Ga0068871_100040644 Ga0068871_1000406444 290
132 3300009098 Ga0105245_10277369 Ga0105245_102773692 290
133 3300025938 Ga0207704_10269386 Ga0207704_102693862 290
134 3300045051 Ga0451576_0366651 Ga0451576_0366651_19_894 291
135 3300009093 Ga0105240_10201236 Ga0105240_102012362 292
136 3300003323 rootH1_10378089 rootH1_103780892 296
137 3300042876 Ga0451577_0011609 Ga0451577_0011609_6025_6978 296
138 3300044712 Ga0453684_0000255 Ga0453684_0000255_191258_192211 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

37

314

0.93

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

70

187

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

237

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9112 5 281
4wpg-assembly1.cif.gz_A group a streptococcus gaca is an essential dtdp-4-dehydrorhamnose reductase (rmld) 0.9055 4 281
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9034 1 278
2ggs-assembly2.cif.gz_B crystal structure of hypothetical dtdp-4-dehydrorhamnose reductase from sulfolobus tokodaii 0.8966 5 270
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.8943 3 283
ID Description Score Start End Superfamily
2ggsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9168 5 269 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9073 5 152 3.40.50.720
2ggsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9037 5 269 3.40.50.720
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8938 4 214 3.40.50.720
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8937 6 220 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A350I0N9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9787 83 280 GO:0009058
AF-A0A2V5XFC2-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9668 3 281 GO:0008831
GO:0019305
AF-A0A350I0N9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9503 83 280 GO:0009058
AF-A0A660Y678-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9377 8 154 GO:0008831
GO:0019305
AF-A0A849WKD2-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9367 1 264 GO:0009058

Feature Viewer

pLDDT pTM Quality
93.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map