F172270

General Info

Members Datasets Scaffolds Average Seq Length
138 39 276 155

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100059705|Ga0070714_1000597054
Length 158
Sequence MANGRQDPAERVREMMERIASAAGVEATVEVHEADDGLHAEYLGDDLGLLIGHHGQTIDAIQHLAYRIASDTTDPSHPRVSVLVDAAGYRERRAQTLRATADQAAQTAISRGHAVPLEAMSALERKVIHEHLKDRHDVETYSEGQEPSRHLVVAPLVD

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
4 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
7 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
8 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
9 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
10 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
11 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
12 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
18 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
19 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
20 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
21 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
22 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
23 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
24 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
25 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
26 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
27 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
28 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
29 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
30 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
31 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
32 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
33 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
34 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
35 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
36 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
37 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
38 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
39 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 73.19
Stem 0
Stem Tuber 0
Unclassified 18.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100059705 3300005435 Bacteria 3271
2 Ga0070714_101188192 3300005435 Unclassified 744
3 Ga0070713_101631980 3300005436 Unclassified 626
4 Ga0070711_100162611 3300005439 Bacteria 1694
5 Ga0070711_101944503 3300005439 Bacteria 517
6 Ga0070706_100628937 3300005467 Bacteria 997
7 Ga0068856_100129568 3300005614 Bacteria 2527
8 Ga0070717_10022338 3300006028 Bacteria 4997
9 Ga0070717_10111854 3300006028 Bacteria 2330
10 Ga0070717_10140318 3300006028 Unclassified 2084
11 Ga0070717_11009750 3300006028 Bacteria 758
12 Ga0070712_100252047 3300006175 Bacteria 1411
13 Ga0070712_100456226 3300006175 Bacteria 1065
14 Ga0070712_100460746 3300006175 Unclassified 1060
15 Ga0213873_10032269 3300021358 Bacteria 1307
16 Ga0213874_10002232 3300021377 Bacteria 4126
17 Ga0213874_10080538 3300021377 Bacteria 1054
18 Ga0213874_10100327 3300021377 Bacteria 961
19 Ga0213876_10006034 3300021384 Bacteria 6621
20 Ga0213876_10046814 3300021384 Bacteria 2287
21 Ga0213876_10069956 3300021384 Bacteria 1854
22 Ga0213876_10421723 3300021384 Bacteria 710
23 Ga0213875_10000131 3300021388 Bacteria 83001
24 Ga0213875_10024887 3300021388 Bacteria 2854
25 Ga0213875_10025562 3300021388 Bacteria 2813
26 Ga0213875_10171151 3300021388 Bacteria 1020
27 Ga0213875_10260204 3300021388 Bacteria 819
28 Ga0207693_10240771 3300025915 Bacteria 1420
29 Ga0207693_10280407 3300025915 Bacteria 1306
30 Ga0207663_10086166 3300025916 Bacteria 2071
31 Ga0207700_11379723 3300025928 Unclassified 627
32 Ga0207664_10145364 3300025929 Bacteria 2010
33 Ga0207664_10694351 3300025929 Bacteria 915
34 Ga0207664_10736364 3300025929 Bacteria 887
35 Ga0207702_10138005 3300026078 Bacteria 2203
36 Ga0207702_11181930 3300026078 Bacteria 759
37 Ga0373954_0433207 3300035118 Bacteria 651
38 Ga0436364_0428614 3300037853 Bacteria 5659
39 Ga0436364_0709867 3300037853 Bacteria 4947
40 Ga0436364_0746030 3300037853 Bacteria 86955
41 Ga0436364_0813404 3300037853 Bacteria 4444
42 Ga0436364_0815724 3300037853 Unclassified 897
43 Ga0436364_0912146 3300037853 Bacteria 1133
44 Ga0436364_1045807 3300037853 Bacteria 1639
45 Ga0436364_1097839 3300037853 Bacteria 4274
46 Ga0436364_1400219 3300037853 Bacteria 3137
47 Ga0436365_0421995 3300039437 Unclassified 837
48 Ga0436365_0562857 3300039437 Bacteria 16304
49 Ga0436365_0595770 3300039437 Bacteria 2769
50 Ga0436365_0620382 3300039437 Bacteria 8118
51 Ga0436365_0975993 3300039437 Unclassified 1191
52 Ga0436365_0981139 3300039437 Unclassified 1088
53 Ga0436365_1117147 3300039437 Bacteria 3151
54 Ga0436365_1455149 3300039437 Bacteria 4881
55 Ga0436365_1757572 3300039437 Bacteria 6240
56 Ga0436363_1265155 3300039450 Bacteria 80087
57 Ga0436363_1330181 3300039450 Unclassified 960
58 Ga0436363_1650577 3300039450 Bacteria 783
59 Ga0436363_1651497 3300039450 Bacteria 1288
60 Ga0436362_0342744 3300039453 Bacteria 2107
61 Ga0436362_0978481 3300039453 Bacteria 3289
62 Ga0466969_0013181 3300044656 Bacteria 4355
63 Ga0466969_0121960 3300044656 Bacteria 1213
64 Ga0466965_0016055 3300044683 Bacteria 3558
65 Ga0466966_0018691 3300044684 Bacteria 4567
66 Ga0466966_0039831 3300044684 Bacteria 3025
67 Ga0466966_0040468 3300044684 Bacteria 3000
68 Ga0466966_0043117 3300044684 Bacteria 2893
69 Ga0466966_0061626 3300044684 Bacteria 2366
70 Ga0466966_0291325 3300044684 Bacteria 981
71 Ga0466966_0625405 3300044684 Bacteria 648
72 Ga0466961_0035914 3300044693 Bacteria 3181
73 Ga0466961_0059822 3300044693 Bacteria 2422
74 Ga0466961_0183431 3300044693 Bacteria 1299
75 Ga0466961_0504814 3300044693 Bacteria 730
76 Ga0466963_0003289 3300044694 Bacteria 9212
77 Ga0466963_0009001 3300044694 Bacteria 5996
78 Ga0466963_0024057 3300044694 Bacteria 3874
79 Ga0466963_0507118 3300044694 Bacteria 852
80 Ga0466963_0577320 3300044694 Unclassified 794
81 Ga0466963_0764542 3300044694 Bacteria 681
82 Ga0466971_0001948 3300044719 Bacteria 8748
83 Ga0466971_0045975 3300044719 Unclassified 1961
84 Ga0466971_0075260 3300044719 Bacteria 1535
85 Ga0466971_0107535 3300044719 Unclassified 1285
86 Ga0466971_0359995 3300044719 Bacteria 705
87 Ga0466968_0202867 3300044735 Unclassified 929
88 Ga0466968_0233276 3300044735 Bacteria 870
89 Ga0466968_0292726 3300044735 Bacteria 781
90 Ga0466968_0355723 3300044735 Bacteria 712
91 Ga0466968_0382560 3300044735 Bacteria 688
92 Ga0466970_0021962 3300044765 Bacteria 3330
93 Ga0466970_0203166 3300044765 Unclassified 1103
94 Ga0466970_0376265 3300044765 Bacteria 808
95 Ga0466970_0403135 3300044765 Unclassified 780
96 Ga0466957_0000888 3300044842 Bacteria 15314
97 Ga0466957_0019026 3300044842 Bacteria 4038
98 Ga0466957_0049738 3300044842 Bacteria 2549
99 Ga0466957_0238903 3300044842 Bacteria 1205
100 Ga0466957_0732248 3300044842 Bacteria 699
101 Ga0466957_1156007 3300044842 Bacteria 559
102 Ga0466959_0003630 3300045049 Bacteria 10180
103 Ga0466959_0009898 3300045049 Bacteria 6794
104 Ga0466959_0018581 3300045049 Bacteria 5105
105 Ga0466959_0063319 3300045049 Bacteria 2686
106 Ga0466959_0072827 3300045049 Bacteria 2486
107 Ga0466959_0113843 3300045049 Bacteria 1928
108 Ga0466959_0183077 3300045049 Unclassified 1465
109 Ga0466959_0186982 3300045049 Bacteria 1447
110 Ga0466959_0210381 3300045049 Unclassified 1352
111 Ga0466959_0619407 3300045049 Bacteria 727
112 Ga0466959_0798751 3300045049 Bacteria 631
113 Ga0466959_0978242 3300045049 Bacteria 564
114 Ga0466958_0000416 3300045836 Bacteria 17574
115 Ga0466958_0002991 3300045836 Bacteria 8661
116 Ga0466958_0100669 3300045836 Unclassified 1797
117 Ga0466958_0205027 3300045836 Bacteria 1255
118 Ga0466958_0240336 3300045836 Unclassified 1157
119 Ga0466958_0240570 3300045836 Bacteria 1157
120 Ga0466958_0430952 3300045836 Bacteria 853
121 Ga0466958_0507692 3300045836 Bacteria 782
122 Ga0466958_0610763 3300045836 Bacteria 709
123 Ga0466958_0679484 3300045836 Bacteria 670
124 Ga0466958_0770754 3300045836 Unclassified 627
125 Ga0466967_0024284 3300045976 Bacteria 4982
126 Ga0466967_0061064 3300045976 Bacteria 3343
127 Ga0466967_0176078 3300045976 Bacteria 2015
128 Ga0466967_0527028 3300045976 Bacteria 1161
129 Ga0466967_0576181 3300045976 Unclassified 1109
130 Ga0466967_0845075 3300045976 Bacteria 909
131 Ga0466967_2606513 3300045976 Bacteria 500
132 Ga0495604_0581134 3300047317 Bacteria 720
133 Ga0495602_0480482 3300048088 Unclassified 872
134 Ga0496105_0763874 3300048908 Unclassified 737
135 Ga0496108_1544394 3300048911 Bacteria 551
136 Ga0496115_1168719 3300048918 Bacteria 580
137 Ga0466962_0039275 3300061719 Unclassified 2267
138 Ga0466962_0676553 3300061719 Bacteria 528
139 Ga0070714_100059705
140 Ga0070714_101188192
141 Ga0070713_101631980
142 Ga0070711_100162611
143 Ga0070711_101944503
144 Ga0070706_100628937
145 Ga0068856_100129568
146 Ga0070717_10022338
147 Ga0070717_10111854
148 Ga0070717_10140318
149 Ga0070717_11009750
150 Ga0070712_100252047
151 Ga0070712_100456226
152 Ga0070712_100460746
153 Ga0213873_10032269
154 Ga0213874_10002232
155 Ga0213874_10080538
156 Ga0213874_10100327
157 Ga0213876_10006034
158 Ga0213876_10046814
159 Ga0213876_10069956
160 Ga0213876_10421723
161 Ga0213875_10000131
162 Ga0213875_10024887
163 Ga0213875_10025562
164 Ga0213875_10171151
165 Ga0213875_10260204
166 Ga0207693_10240771
167 Ga0207693_10280407
168 Ga0207663_10086166
169 Ga0207700_11379723
170 Ga0207664_10145364
171 Ga0207664_10694351
172 Ga0207664_10736364
173 Ga0207702_10138005
174 Ga0207702_11181930
175 Ga0373954_0433207
176 Ga0436364_0428614
177 Ga0436364_0709867
178 Ga0436364_0746030
179 Ga0436364_0813404
180 Ga0436364_0815724
181 Ga0436364_0912146
182 Ga0436364_1045807
183 Ga0436364_1097839
184 Ga0436364_1400219
185 Ga0436365_0421995
186 Ga0436365_0562857
187 Ga0436365_0595770
188 Ga0436365_0620382
189 Ga0436365_0975993
190 Ga0436365_0981139
191 Ga0436365_1117147
192 Ga0436365_1455149
193 Ga0436365_1757572
194 Ga0436363_1265155
195 Ga0436363_1330181
196 Ga0436363_1650577
197 Ga0436363_1651497
198 Ga0436362_0342744
199 Ga0436362_0978481
200 Ga0466969_0013181
201 Ga0466969_0121960
202 Ga0466965_0016055
203 Ga0466966_0018691
204 Ga0466966_0039831
205 Ga0466966_0040468
206 Ga0466966_0043117
207 Ga0466966_0061626
208 Ga0466966_0291325
209 Ga0466966_0625405
210 Ga0466961_0035914
211 Ga0466961_0059822
212 Ga0466961_0183431
213 Ga0466961_0504814
214 Ga0466963_0003289
215 Ga0466963_0009001
216 Ga0466963_0024057
217 Ga0466963_0507118
218 Ga0466963_0577320
219 Ga0466963_0764542
220 Ga0466971_0001948
221 Ga0466971_0045975
222 Ga0466971_0075260
223 Ga0466971_0107535
224 Ga0466971_0359995
225 Ga0466968_0202867
226 Ga0466968_0233276
227 Ga0466968_0292726
228 Ga0466968_0355723
229 Ga0466968_0382560
230 Ga0466970_0021962
231 Ga0466970_0203166
232 Ga0466970_0376265
233 Ga0466970_0403135
234 Ga0466957_0000888
235 Ga0466957_0019026
236 Ga0466957_0049738
237 Ga0466957_0238903
238 Ga0466957_0732248
239 Ga0466957_1156007
240 Ga0466959_0003630
241 Ga0466959_0009898
242 Ga0466959_0018581
243 Ga0466959_0063319
244 Ga0466959_0072827
245 Ga0466959_0113843
246 Ga0466959_0183077
247 Ga0466959_0186982
248 Ga0466959_0210381
249 Ga0466959_0619407
250 Ga0466959_0798751
251 Ga0466959_0978242
252 Ga0466958_0000416
253 Ga0466958_0002991
254 Ga0466958_0100669
255 Ga0466958_0205027
256 Ga0466958_0240336
257 Ga0466958_0240570
258 Ga0466958_0430952
259 Ga0466958_0507692
260 Ga0466958_0610763
261 Ga0466958_0679484
262 Ga0466958_0770754
263 Ga0466967_0024284
264 Ga0466967_0061064
265 Ga0466967_0176078
266 Ga0466967_0527028
267 Ga0466967_0576181
268 Ga0466967_0845075
269 Ga0466967_2606513
270 Ga0495604_0581134
271 Ga0495602_0480482
272 Ga0496105_0763874
273 Ga0496108_1544394
274 Ga0496115_1168719
275 Ga0466962_0039275
276 Ga0466962_0676553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

95

155

0.96

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

9

82

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gku-assembly1.cif.gz_B crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.9081 6 156
3gku-assembly1.cif.gz_B crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8591 6 156
3gku-assembly1.cif.gz_A crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8487 6 158
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8244 6 93
3gku-assembly1.cif.gz_A crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8148 6 158
ID Description Score Start End Superfamily
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9802 89 156 3.30.1370.50
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9524 89 156 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9359 93 155 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8957 93 155 3.30.1370.50
af_A0A1D6LWY5_666_733_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8649 114 153 3.30.1370.50
ID Description Score Start End GO Terms
AF-A0A6I2VDP9-F1-model_v4 Protein jag 0.9929 87 158 GO:0003723
AF-A0A521RY04-F1-model_v4 Protein jag 0.9893 89 158 GO:0003723
AF-A0A7W1S8I1-F1-model_v4 Protein jag 0.9862 89 156 GO:0003723
AF-A0A350TK17-F1-model_v4 R3H domain-containing protein 0.9818 88 155 GO:0003723
AF-A0A535RMK8-F1-model_v4 R3H domain-containing protein 0.9801 94 155 GO:0003723

Map