F172053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 138 | 111 | 138 | 460 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10018746|Ga0070666_100187466 |
| Length | 468 |
| Sequence | VNLPFTLPSAHALVARQDLPIPAWLFAWAASIVLIVSFFALSAAWRRPIFEEQHWRSIGRDDAVRAFTGSVAQAVYGAIGVALLAVAIYAGLHGTEAPDRNFALTFLFVTCWLGFPFLSAIFGDLFRPFNPWRALGRAAGVALSAAGVPHPRKLAYPERLGRWPAAIGLLAVVWLEVVYGASGGIAVGLDPHSCAVAACVYSVYTLAMMALFGVEKWCQTGEIFSVYFGMFSQLGLFGARDGRLGRRRPLAAATSWAAIPGSAAVVIASIASTSFDGSQEGAFKGAIEKVVGWVGDLGLGPTASLRLSNTIFMVLCFAGVALVYELGVRGMQSVPGAPSRERLRTAFAHTLIPIALAYLIAHYFSLFVFQEQAQFTYLLSDPLGTGHTDLFGTAEVGIDFAVLSSQTIWYVQVAALVAGHVLGLTLAHDRALSIWSDPRRATRSQYWMLAVMVAFTCFGLYLLSAGNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 17 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 18 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 19 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 20 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 23 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 61 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 62 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 63 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 64 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 84 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 86 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 87 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 88 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 89 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 90 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 92 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 93 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 94 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 95 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 96 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 97 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 98 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 99 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 100 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 101 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 102 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 111 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.45 |
| Nodule | 0 |
| Rhizoplane | 13.04 |
| Rhizosphere | 81.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100006003 | 3300005329 | Bacteria | 10175 |
| 2 | Ga0070666_10018746 | 3300005335 | Bacteria | 4455 |
| 3 | Ga0068868_100000104 | 3300005338 | Bacteria | 52249 |
| 4 | Ga0070691_10000013 | 3300005341 | Bacteria | 50559 |
| 5 | Ga0070691_10006436 | 3300005341 | Bacteria | 5367 |
| 6 | Ga0070661_100000110 | 3300005344 | Bacteria | 68106 |
| 7 | Ga0070674_100000030 | 3300005356 | Bacteria | 69481 |
| 8 | Ga0070688_100000053 | 3300005365 | Bacteria | 55064 |
| 9 | Ga0070713_100000023 | 3300005436 | Bacteria | 98528 |
| 10 | Ga0070711_100016591 | 3300005439 | Plasmid | 4678 |
| 11 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 12 | Ga0070685_10000032 | 3300005466 | Bacteria | 84253 |
| 13 | Ga0070684_100025844 | 3300005535 | Bacteria | 4939 |
| 14 | Ga0070684_100050545 | 3300005535 | Bacteria | 3611 |
| 15 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 16 | Ga0070665_100016069 | 3300005548 | Bacteria | 7511 |
| 17 | Ga0070665_100038262 | 3300005548 | Bacteria | 4822 |
| 18 | Ga0068856_100020021 | 3300005614 | Bacteria | 6495 |
| 19 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 20 | Ga0068864_100000043 | 3300005618 | Bacteria | 162928 |
| 21 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 22 | Ga0068866_10000130 | 3300005718 | Bacteria | 33217 |
| 23 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 24 | Ga0068858_100045052 | 3300005842 | Bacteria | 4088 |
| 25 | Ga0081455_10112038 | 3300005937 | Unclassified | 2166 |
| 26 | Ga0081540_1000106 | 3300005983 | Bacteria | 89767 |
| 27 | Ga0068865_100000081 | 3300006881 | Bacteria | 51047 |
| 28 | Ga0105245_10000303 | 3300009098 | Bacteria | 47259 |
| 29 | Ga0105247_10000148 | 3300009101 | Bacteria | 68936 |
| 30 | Ga0105247_10027723 | 3300009101 | Unclassified | 3425 |
| 31 | Ga0105243_10037862 | 3300009148 | Bacteria | 3753 |
| 32 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 33 | Ga0105242_10044299 | 3300009176 | Bacteria | 3603 |
| 34 | Ga0105242_10098837 | 3300009176 | Bacteria | 2469 |
| 35 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 36 | Ga0157370_10003677 | 3300013104 | Bacteria | 17915 |
| 37 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 38 | Ga0157378_10013905 | 3300013297 | Bacteria | 7039 |
| 39 | Ga0157378_10039099 | 3300013297 | Bacteria | 4207 |
| 40 | Ga0157378_10112189 | 3300013297 | Bacteria | 2501 |
| 41 | Ga0157375_10003402 | 3300013308 | Bacteria | 13791 |
| 42 | Ga0157375_10018573 | 3300013308 | Bacteria | 6307 |
| 43 | Ga0157375_10443638 | 3300013308 | Bacteria | 1463 |
| 44 | Ga0157380_10000186 | 3300014326 | Bacteria | 35981 |
| 45 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 46 | Ga0207642_10000047 | 3300025899 | Bacteria | 35336 |
| 47 | Ga0207710_10000336 | 3300025900 | Bacteria | 35206 |
| 48 | Ga0207680_10007274 | 3300025903 | Bacteria | 5387 |
| 49 | Ga0207693_10001233 | 3300025915 | Bacteria | 22785 |
| 50 | Ga0207663_10001354 | 3300025916 | Bacteria | 11343 |
| 51 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 52 | Ga0207650_10042580 | 3300025925 | Bacteria | 3331 |
| 53 | Ga0207659_10000707 | 3300025926 | Bacteria | 19793 |
| 54 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 55 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 56 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 57 | Ga0207686_10000119 | 3300025934 | Bacteria | 64297 |
| 58 | Ga0207686_10010369 | 3300025934 | Bacteria | 5074 |
| 59 | Ga0207669_10000029 | 3300025937 | Bacteria | 88351 |
| 60 | Ga0207669_10000047 | 3300025937 | Bacteria | 60937 |
| 61 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 62 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 63 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 64 | Ga0207661_10018599 | 3300025944 | Bacteria | 5164 |
| 65 | Ga0207661_10052985 | 3300025944 | Bacteria | 3244 |
| 66 | Ga0207679_10050318 | 3300025945 | Bacteria | 3044 |
| 67 | Ga0207658_10013436 | 3300025986 | Bacteria | 5593 |
| 68 | Ga0207658_10237682 | 3300025986 | Bacteria | 1541 |
| 69 | Ga0207677_10000639 | 3300026023 | Bacteria | 21111 |
| 70 | Ga0207677_10004707 | 3300026023 | Bacteria | 7351 |
| 71 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 72 | Ga0207708_10043280 | 3300026075 | Bacteria | 3432 |
| 73 | Ga0207702_10000690 | 3300026078 | Bacteria | 36486 |
| 74 | Ga0207676_10000042 | 3300026095 | Bacteria | 163475 |
| 75 | Ga0207683_10035899 | 3300026121 | Bacteria | 4312 |
| 76 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 77 | Ga0268266_10000485 | 3300028379 | Bacteria | 57051 |
| 78 | Ga0268266_10019755 | 3300028379 | Bacteria | 5741 |
| 79 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 80 | Ga0307409_100171976 | 3300031995 | Bacteria | 1908 |
| 81 | Ga0307415_100002865 | 3300032126 | Bacteria | 8633 |
| 82 | Ga0466957_0041970 | 3300044842 | Bacteria | 2767 |
| 83 | Ga0495629_0000899 | 3300046459 | Bacteria | 23864 |
| 84 | Ga0495629_0044657 | 3300046459 | Bacteria | 3110 |
| 85 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 86 | Ga0495606_0000895 | 3300046507 | Bacteria | 44393 |
| 87 | Ga0495608_0026289 | 3300046511 | Bacteria | 3969 |
| 88 | Ga0495628_0091919 | 3300046516 | Bacteria | 2348 |
| 89 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 90 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 91 | Ga0495652_0041056 | 3300046529 | Bacteria | 3995 |
| 92 | Ga0495621_0002341 | 3300046539 | Bacteria | 5091 |
| 93 | Ga0495622_0000578 | 3300046557 | Bacteria | 21905 |
| 94 | Ga0495625_0000395 | 3300046660 | Bacteria | 66640 |
| 95 | Ga0495588_0000266 | 3300046674 | Bacteria | 40474 |
| 96 | Ga0495647_0003765 | 3300046681 | Bacteria | 4878 |
| 97 | Ga0495647_0028485 | 3300046681 | Bacteria | 2060 |
| 98 | Ga0495669_0019050 | 3300046684 | Bacteria | 2959 |
| 99 | Ga0495613_0088619 | 3300046689 | Bacteria | 2242 |
| 100 | Ga0495670_0003379 | 3300046691 | Bacteria | 7851 |
| 101 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 102 | Ga0495676_0017892 | 3300047321 | Bacteria | 6255 |
| 103 | Ga0495680_0060083 | 3300047322 | Bacteria | 2932 |
| 104 | Ga0495686_0059626 | 3300047472 | Unclassified | 2375 |
| 105 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 106 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 107 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 108 | Ga0496102_0025877 | 3300048905 | Bacteria | 5227 |
| 109 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 110 | Ga0496103_0037063 | 3300048906 | Bacteria | 2988 |
| 111 | Ga0496106_0003626 | 3300048909 | Bacteria | 11519 |
| 112 | Ga0496107_0002003 | 3300048910 | Bacteria | 12994 |
| 113 | Ga0496108_0008572 | 3300048911 | Bacteria | 8290 |
| 114 | Ga0496108_0037870 | 3300048911 | Bacteria | 4018 |
| 115 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 116 | Ga0496109_0000589 | 3300048912 | Bacteria | 30428 |
| 117 | Ga0496110_0000185 | 3300048913 | Bacteria | 39094 |
| 118 | Ga0496111_0000103 | 3300048914 | Bacteria | 36804 |
| 119 | Ga0496112_0000026 | 3300048915 | Bacteria | 144758 |
| 120 | Ga0496113_0074020 | 3300048916 | Unclassified | 2596 |
| 121 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 122 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 123 | Ga0496116_0000120 | 3300048919 | Bacteria | 166804 |
| 124 | Ga0496117_0029648 | 3300048920 | Bacteria | 4214 |
| 125 | Ga0496118_0020242 | 3300048921 | Bacteria | 5908 |
| 126 | Ga0496119_0026820 | 3300048922 | Bacteria | 3982 |
| 127 | Ga0496120_0004697 | 3300048923 | Bacteria | 11270 |
| 128 | Ga0501047_0067101 | 3300049581 | Bacteria | 3458 |
| 129 | Ga0501070_0011298 | 3300049586 | Bacteria | 7544 |
| 130 | Ga0501072_0208856 | 3300049588 | Bacteria | 1556 |
| 131 | Ga0501075_0001931 | 3300049591 | Bacteria | 13671 |
| 132 | nmdc:mga0a205_281_c1 | 3300050515 | Bacteria | 37267 |
| 133 | Ga0495612_0009442 | 3300053078 | Bacteria | 3957 |
| 134 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 135 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 136 | Ga0495619_0000067 | 3300053085 | Bacteria | 83418 |
| 137 | Ga0500566_0002787 | 3300053094 | Bacteria | 10417 |
| 138 | Ga0500628_000024 | 3300053129 | Bacteria | 64538 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0208856 | Ga0501072_0208856_47_1321 | 386 |
| 2 | 3300048920 | Ga0496117_0029648 | Ga0496117_0029648_3006_4199 | 397 |
| 3 | 3300031995 | Ga0307409_100171976 | Ga0307409_1001719761 | 417 |
| 4 | 3300046689 | Ga0495613_0088619 | Ga0495613_0088619_196_1602 | 441 |
| 5 | 3300044842 | Ga0466957_0041970 | Ga0466957_0041970_433_1761 | 442 |
| 6 | 3300046684 | Ga0495669_0019050 | Ga0495669_0019050_752_2155 | 444 |
| 7 | 3300048916 | Ga0496113_0074020 | Ga0496113_0074020_406_1809 | 444 |
| 8 | 3300009176 | Ga0105242_10044299 | Ga0105242_100442992 | 446 |
| 9 | 3300025934 | Ga0207686_10010369 | Ga0207686_100103692 | 446 |
| 10 | 3300046681 | Ga0495647_0028485 | Ga0495647_0028485_139_1542 | 446 |
| 11 | 3300013104 | Ga0157370_10003677 | Ga0157370_100036774 | 447 |
| 12 | 3300013297 | Ga0157378_10039099 | Ga0157378_100390995 | 447 |
| 13 | 3300050515 | nmdc:mga0a205_281_c1 | nmdc:mga0a205_281_c1_2516_3955 | 447 |
| 14 | 3300005842 | Ga0068858_100000017 | Ga0068858_100000017174 | 448 |
| 15 | 3300026035 | Ga0207703_10000030 | Ga0207703_10000030170 | 448 |
| 16 | 3300048911 | Ga0496108_0037870 | Ga0496108_0037870_906_2303 | 448 |
| 17 | 3300048912 | Ga0496109_0000589 | Ga0496109_0000589_22863_24260 | 448 |
| 18 | 3300005338 | Ga0068868_100000104 | Ga0068868_10000010411 | 449 |
| 19 | 3300026023 | Ga0207677_10000639 | Ga0207677_100006394 | 449 |
| 20 | 3300047472 | Ga0495686_0059626 | Ga0495686_0059626_693_2087 | 449 |
| 21 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_350142_351548 | 451 |
| 22 | 3300025986 | Ga0207658_10237682 | Ga0207658_102376822 | 452 |
| 23 | 3300046557 | Ga0495622_0000578 | Ga0495622_0000578_5894_7297 | 452 |
| 24 | 3300005356 | Ga0070674_100000030 | Ga0070674_10000003010 | 456 |
| 25 | 3300005718 | Ga0068866_10000130 | Ga0068866_100001307 | 456 |
| 26 | 3300009148 | Ga0105243_10037862 | Ga0105243_100378623 | 456 |
| 27 | 3300009176 | Ga0105242_10098837 | Ga0105242_100988372 | 456 |
| 28 | 3300025899 | Ga0207642_10000047 | Ga0207642_100000477 | 456 |
| 29 | 3300025937 | Ga0207669_10000029 | Ga0207669_1000002938 | 456 |
| 30 | 3300013308 | Ga0157375_10003402 | Ga0157375_1000340211 | 457 |
| 31 | 3300005439 | Ga0070711_100016591 | Ga0070711_1000165915 | 460 |
| 32 | 3300025915 | Ga0207693_10001233 | Ga0207693_100012336 | 460 |
| 33 | 3300025916 | Ga0207663_10001354 | Ga0207663_100013545 | 460 |
| 34 | 3300048911 | Ga0496108_0008572 | Ga0496108_0008572_2498_3880 | 460 |
| 35 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_30052_31434 | 460 |
| 36 | 3300005344 | Ga0070661_100000110 | Ga0070661_10000011030 | 461 |
| 37 | 3300005365 | Ga0070688_100000053 | Ga0070688_1000000534 | 461 |
| 38 | 3300005535 | Ga0070684_100050545 | Ga0070684_1000505453 | 461 |
| 39 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000570 | 461 |
| 40 | 3300005548 | Ga0070665_100016069 | Ga0070665_1000160694 | 461 |
| 41 | 3300013297 | Ga0157378_10013905 | Ga0157378_100139054 | 461 |
| 42 | 3300013308 | Ga0157375_10443638 | Ga0157375_104436381 | 461 |
| 43 | 3300014326 | Ga0157380_10000186 | Ga0157380_1000018628 | 461 |
| 44 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015212 | 461 |
| 45 | 3300025926 | Ga0207659_10000707 | Ga0207659_100007073 | 461 |
| 46 | 3300025940 | Ga0207691_10000028 | Ga0207691_1000002860 | 461 |
| 47 | 3300025944 | Ga0207661_10052985 | Ga0207661_100529854 | 461 |
| 48 | 3300025945 | Ga0207679_10050318 | Ga0207679_100503184 | 461 |
| 49 | 3300026023 | Ga0207677_10004707 | Ga0207677_100047078 | 461 |
| 50 | 3300028379 | Ga0268266_10019755 | Ga0268266_100197554 | 461 |
| 51 | 3300032126 | Ga0307415_100002865 | Ga0307415_1000028655 | 461 |
| 52 | 3300046459 | Ga0495629_0000899 | Ga0495629_0000899_6376_7764 | 462 |
| 53 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001168 | 463 |
| 54 | 3300005466 | Ga0070685_10000032 | Ga0070685_100000324 | 463 |
| 55 | 3300005614 | Ga0068856_100020021 | Ga0068856_1000200216 | 463 |
| 56 | 3300005616 | Ga0068852_100000037 | Ga0068852_10000003759 | 463 |
| 57 | 3300009098 | Ga0105245_10000303 | Ga0105245_100003034 | 463 |
| 58 | 3300009101 | Ga0105247_10027723 | Ga0105247_100277234 | 463 |
| 59 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017245 | 463 |
| 60 | 3300013105 | Ga0157369_10000105 | Ga0157369_1000010553 | 463 |
| 61 | 3300025927 | Ga0207687_10000040 | Ga0207687_1000004077 | 463 |
| 62 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003163 | 463 |
| 63 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011292 | 463 |
| 64 | 3300026078 | Ga0207702_10000690 | Ga0207702_100006904 | 463 |
| 65 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015181 | 463 |
| 66 | 3300046507 | Ga0495606_0000895 | Ga0495606_0000895_17905_19299 | 463 |
| 67 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_572_1966 | 463 |
| 68 | 3300046674 | Ga0495588_0000266 | Ga0495588_0000266_33051_34445 | 463 |
| 69 | 3300046681 | Ga0495647_0003765 | Ga0495647_0003765_3028_4422 | 463 |
| 70 | 3300048913 | Ga0496110_0000185 | Ga0496110_0000185_21668_23059 | 463 |
| 71 | 3300048914 | Ga0496111_0000103 | Ga0496111_0000103_30323_31714 | 463 |
| 72 | 3300053085 | Ga0495619_0000067 | Ga0495619_0000067_25226_26617 | 463 |
| 73 | 3300005341 | Ga0070691_10000013 | Ga0070691_100000139 | 464 |
| 74 | 3300005341 | Ga0070691_10006436 | Ga0070691_100064363 | 464 |
| 75 | 3300005436 | Ga0070713_100000023 | Ga0070713_10000002398 | 464 |
| 76 | 3300005618 | Ga0068864_100000043 | Ga0068864_10000004397 | 464 |
| 77 | 3300005983 | Ga0081540_1000106 | Ga0081540_100010630 | 464 |
| 78 | 3300006881 | Ga0068865_100000081 | Ga0068865_10000008151 | 464 |
| 79 | 3300009101 | Ga0105247_10000148 | Ga0105247_1000014854 | 464 |
| 80 | 3300009176 | Ga0105242_10000052 | Ga0105242_1000005242 | 464 |
| 81 | 3300013297 | Ga0157378_10112189 | Ga0157378_101121893 | 464 |
| 82 | 3300013308 | Ga0157375_10018573 | Ga0157375_100185736 | 464 |
| 83 | 3300025900 | Ga0207710_10000336 | Ga0207710_1000033625 | 464 |
| 84 | 3300025925 | Ga0207650_10042580 | Ga0207650_100425803 | 464 |
| 85 | 3300025928 | Ga0207700_10000003 | Ga0207700_1000000398 | 464 |
| 86 | 3300025934 | Ga0207686_10000119 | Ga0207686_1000011928 | 464 |
| 87 | 3300025938 | Ga0207704_10000018 | Ga0207704_1000001895 | 464 |
| 88 | 3300026075 | Ga0207708_10043280 | Ga0207708_100432803 | 464 |
| 89 | 3300026095 | Ga0207676_10000042 | Ga0207676_1000004270 | 464 |
| 90 | 3300026121 | Ga0207683_10035899 | Ga0207683_100358996 | 464 |
| 91 | 3300046459 | Ga0495629_0044657 | Ga0495629_0044657_944_2338 | 464 |
| 92 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_164344_165747 | 464 |
| 93 | 3300046660 | Ga0495625_0000395 | Ga0495625_0000395_62720_64114 | 464 |
| 94 | 3300046691 | Ga0495670_0003379 | Ga0495670_0003379_4286_5686 | 464 |
| 95 | 3300047321 | Ga0495676_0017892 | Ga0495676_0017892_4244_5638 | 464 |
| 96 | 3300047322 | Ga0495680_0060083 | Ga0495680_0060083_1018_2412 | 464 |
| 97 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_8598_9992 | 464 |
| 98 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_8587_9981 | 464 |
| 99 | 3300048905 | Ga0496102_0000129 | Ga0496102_0000129_46054_47448 | 464 |
| 100 | 3300048905 | Ga0496102_0025877 | Ga0496102_0025877_1469_2872 | 464 |
| 101 | 3300048906 | Ga0496103_0000087 | Ga0496103_0000087_46052_47446 | 464 |
| 102 | 3300048909 | Ga0496106_0003626 | Ga0496106_0003626_1531_2925 | 464 |
| 103 | 3300048910 | Ga0496107_0002003 | Ga0496107_0002003_1538_2932 | 464 |
| 104 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_415816_417210 | 464 |
| 105 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_142103_143497 | 464 |
| 106 | 3300048921 | Ga0496118_0020242 | Ga0496118_0020242_1470_2873 | 464 |
| 107 | 3300049591 | Ga0501075_0001931 | Ga0501075_0001931_183_1583 | 464 |
| 108 | 3300053078 | Ga0495612_0009442 | Ga0495612_0009442_2131_3525 | 464 |
| 109 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_66749_68143 | 464 |
| 110 | 3300053094 | Ga0500566_0002787 | Ga0500566_0002787_2968_4362 | 464 |
| 111 | 3300053129 | Ga0500628_000024 | Ga0500628_000024_41262_42656 | 464 |
| 112 | 3300005329 | Ga0070683_100006003 | Ga0070683_10000600312 | 465 |
| 113 | 3300005335 | Ga0070666_10018746 | Ga0070666_100187466 | 465 |
| 114 | 3300005535 | Ga0070684_100025844 | Ga0070684_1000258445 | 465 |
| 115 | 3300005548 | Ga0070665_100038262 | Ga0070665_1000382626 | 465 |
| 116 | 3300005718 | Ga0068866_10000005 | Ga0068866_1000000581 | 465 |
| 117 | 3300005842 | Ga0068858_100045052 | Ga0068858_1000450525 | 465 |
| 118 | 3300005937 | Ga0081455_10112038 | Ga0081455_101120383 | 465 |
| 119 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005286 | 465 |
| 120 | 3300025903 | Ga0207680_10007274 | Ga0207680_100072747 | 465 |
| 121 | 3300025937 | Ga0207669_10000047 | Ga0207669_100000473 | 465 |
| 122 | 3300025944 | Ga0207661_10018599 | Ga0207661_100185993 | 465 |
| 123 | 3300025986 | Ga0207658_10013436 | Ga0207658_100134367 | 465 |
| 124 | 3300028379 | Ga0268266_10000485 | Ga0268266_1000048535 | 465 |
| 125 | 3300028800 | Ga0265338_10000051 | Ga0265338_1000005125 | 465 |
| 126 | 3300046499 | Ga0495594_0000012 | Ga0495594_0000012_54314_55717 | 465 |
| 127 | 3300046511 | Ga0495608_0026289 | Ga0495608_0026289_1074_2471 | 465 |
| 128 | 3300046516 | Ga0495628_0091919 | Ga0495628_0091919_154_1557 | 465 |
| 129 | 3300046529 | Ga0495652_0041056 | Ga0495652_0041056_167_1570 | 465 |
| 130 | 3300046539 | Ga0495621_0002341 | Ga0495621_0002341_1434_2831 | 465 |
| 131 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_10339_11742 | 465 |
| 132 | 3300048906 | Ga0496103_0037063 | Ga0496103_0037063_503_1909 | 465 |
| 133 | 3300048915 | Ga0496112_0000026 | Ga0496112_0000026_97132_98529 | 465 |
| 134 | 3300048919 | Ga0496116_0000120 | Ga0496116_0000120_105399_106805 | 465 |
| 135 | 3300048922 | Ga0496119_0026820 | Ga0496119_0026820_551_1957 | 465 |
| 136 | 3300048923 | Ga0496120_0004697 | Ga0496120_0004697_2488_3894 | 465 |
| 137 | 3300049581 | Ga0501047_0067101 | Ga0501047_0067101_472_1878 | 465 |
| 138 | 3300049586 | Ga0501070_0011298 | Ga0501070_0011298_4589_5995 | 465 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iyz-assembly1.cif.gz_A | structure of aquaporin-4 s180d mutant at 10.0 a resolution from electron micrograph | 0.2858 | 19 | 226 |
| 5goy-assembly1.cif.gz_A | the crystal structure of human cytosolic methionyl-trna synthetase in complex with methionine | 0.2791 | 261 | 417 |
| 3gd8-assembly1.cif.gz_A | crystal structure of human aquaporin 4 at 1.8 and its mechanism of conductance | 0.2746 | 20 | 226 |
| 1rsv-assembly1.cif.gz_A | azide complex of the diferrous e238a mutant r2 subunit of ribonucleotide reductase | 0.2628 | 159 | 402 |
| 3iyz-assembly1.cif.gz_A | structure of aquaporin-4 s180d mutant at 10.0 a resolution from electron micrograph | 0.2555 | 19 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8MMS1_490_618_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.325 | 266 | 358 | 1.20.140.10 |
| af_A0A1D6MF11_37_285_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.3235 | 60 | 229 | 1.20.1080.10 |
| af_A0A0R4IKR8_772_977_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.3206 | 259 | 460 | 1.20.1410.10 |
| af_P34355_479_609_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.3106 | 267 | 358 | 1.20.140.10 |
| af_Q9R0H0_480_611_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.3103 | 266 | 368 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3NGK6-F1-model_v4 | deleted | 0.9476 | 8 | 465 |
|
| AF-A0A1Q3ND22-F1-model_v4 | deleted | 0.9411 | 164 | 465 |
|
| AF-A0A6I2YA95-F1-model_v4 | Fenitrothion hydrolase | 0.9394 | 12 | 465 |
GO:0016020
GO:0016787 |
| AF-A0A1Q3NGK6-F1-model_v4 | deleted | 0.9376 | 8 | 465 |
|
| AF-A0A538CPZ3-F1-model_v4 | Fenitrothion hydrolase | 0.9362 | 67 | 232 |
GO:0016020
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar