F172053

General Info

Members Datasets Scaffolds Average Seq Length
138 111 138 460

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10018746|Ga0070666_100187466
Length 468
Sequence VNLPFTLPSAHALVARQDLPIPAWLFAWAASIVLIVSFFALSAAWRRPIFEEQHWRSIGRDDAVRAFTGSVAQAVYGAIGVALLAVAIYAGLHGTEAPDRNFALTFLFVTCWLGFPFLSAIFGDLFRPFNPWRALGRAAGVALSAAGVPHPRKLAYPERLGRWPAAIGLLAVVWLEVVYGASGGIAVGLDPHSCAVAACVYSVYTLAMMALFGVEKWCQTGEIFSVYFGMFSQLGLFGARDGRLGRRRPLAAATSWAAIPGSAAVVIASIASTSFDGSQEGAFKGAIEKVVGWVGDLGLGPTASLRLSNTIFMVLCFAGVALVYELGVRGMQSVPGAPSRERLRTAFAHTLIPIALAYLIAHYFSLFVFQEQAQFTYLLSDPLGTGHTDLFGTAEVGIDFAVLSSQTIWYVQVAALVAGHVLGLTLAHDRALSIWSDPRRATRSQYWMLAVMVAFTCFGLYLLSAGNG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
76 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
108 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
111 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 13.04
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100006003 3300005329 Bacteria 10175
2 Ga0070666_10018746 3300005335 Bacteria 4455
3 Ga0068868_100000104 3300005338 Bacteria 52249
4 Ga0070691_10000013 3300005341 Bacteria 50559
5 Ga0070691_10006436 3300005341 Bacteria 5367
6 Ga0070661_100000110 3300005344 Bacteria 68106
7 Ga0070674_100000030 3300005356 Bacteria 69481
8 Ga0070688_100000053 3300005365 Bacteria 55064
9 Ga0070713_100000023 3300005436 Bacteria 98528
10 Ga0070711_100016591 3300005439 Plasmid 4678
11 Ga0070662_100000001 3300005457 Bacteria 317995
12 Ga0070685_10000032 3300005466 Bacteria 84253
13 Ga0070684_100025844 3300005535 Bacteria 4939
14 Ga0070684_100050545 3300005535 Bacteria 3611
15 Ga0070672_100000005 3300005543 Bacteria 121014
16 Ga0070665_100016069 3300005548 Bacteria 7511
17 Ga0070665_100038262 3300005548 Bacteria 4822
18 Ga0068856_100020021 3300005614 Bacteria 6495
19 Ga0068852_100000037 3300005616 Bacteria 97602
20 Ga0068864_100000043 3300005618 Bacteria 162928
21 Ga0068866_10000005 3300005718 Bacteria 196339
22 Ga0068866_10000130 3300005718 Bacteria 33217
23 Ga0068858_100000017 3300005842 Bacteria 186913
24 Ga0068858_100045052 3300005842 Bacteria 4088
25 Ga0081455_10112038 3300005937 Unclassified 2166
26 Ga0081540_1000106 3300005983 Bacteria 89767
27 Ga0068865_100000081 3300006881 Bacteria 51047
28 Ga0105245_10000303 3300009098 Bacteria 47259
29 Ga0105247_10000148 3300009101 Bacteria 68936
30 Ga0105247_10027723 3300009101 Unclassified 3425
31 Ga0105243_10037862 3300009148 Bacteria 3753
32 Ga0105242_10000052 3300009176 Bacteria 79244
33 Ga0105242_10044299 3300009176 Bacteria 3603
34 Ga0105242_10098837 3300009176 Bacteria 2469
35 Ga0105248_10000017 3300009177 Bacteria 298089
36 Ga0157370_10003677 3300013104 Bacteria 17915
37 Ga0157369_10000105 3300013105 Bacteria 117996
38 Ga0157378_10013905 3300013297 Bacteria 7039
39 Ga0157378_10039099 3300013297 Bacteria 4207
40 Ga0157378_10112189 3300013297 Bacteria 2501
41 Ga0157375_10003402 3300013308 Bacteria 13791
42 Ga0157375_10018573 3300013308 Bacteria 6307
43 Ga0157375_10443638 3300013308 Bacteria 1463
44 Ga0157380_10000186 3300014326 Bacteria 35981
45 Ga0207642_10000005 3300025899 Bacteria 401934
46 Ga0207642_10000047 3300025899 Bacteria 35336
47 Ga0207710_10000336 3300025900 Bacteria 35206
48 Ga0207680_10007274 3300025903 Bacteria 5387
49 Ga0207693_10001233 3300025915 Bacteria 22785
50 Ga0207663_10001354 3300025916 Bacteria 11343
51 Ga0207649_10000015 3300025920 Bacteria 245662
52 Ga0207650_10042580 3300025925 Bacteria 3331
53 Ga0207659_10000707 3300025926 Bacteria 19793
54 Ga0207687_10000040 3300025927 Bacteria 113598
55 Ga0207700_10000003 3300025928 Bacteria 500797
56 Ga0207706_10000003 3300025933 Bacteria 345011
57 Ga0207686_10000119 3300025934 Bacteria 64297
58 Ga0207686_10010369 3300025934 Bacteria 5074
59 Ga0207669_10000029 3300025937 Bacteria 88351
60 Ga0207669_10000047 3300025937 Bacteria 60937
61 Ga0207704_10000018 3300025938 Bacteria 153994
62 Ga0207691_10000028 3300025940 Bacteria 121090
63 Ga0207711_10000011 3300025941 Bacteria 518817
64 Ga0207661_10018599 3300025944 Bacteria 5164
65 Ga0207661_10052985 3300025944 Bacteria 3244
66 Ga0207679_10050318 3300025945 Bacteria 3044
67 Ga0207658_10013436 3300025986 Bacteria 5593
68 Ga0207658_10237682 3300025986 Bacteria 1541
69 Ga0207677_10000639 3300026023 Bacteria 21111
70 Ga0207677_10004707 3300026023 Bacteria 7351
71 Ga0207703_10000030 3300026035 Bacteria 199014
72 Ga0207708_10043280 3300026075 Bacteria 3432
73 Ga0207702_10000690 3300026078 Bacteria 36486
74 Ga0207676_10000042 3300026095 Bacteria 163475
75 Ga0207683_10035899 3300026121 Bacteria 4312
76 Ga0207698_10000015 3300026142 Bacteria 207368
77 Ga0268266_10000485 3300028379 Bacteria 57051
78 Ga0268266_10019755 3300028379 Bacteria 5741
79 Ga0265338_10000051 3300028800 Bacteria 211202
80 Ga0307409_100171976 3300031995 Bacteria 1908
81 Ga0307415_100002865 3300032126 Bacteria 8633
82 Ga0466957_0041970 3300044842 Bacteria 2767
83 Ga0495629_0000899 3300046459 Bacteria 23864
84 Ga0495629_0044657 3300046459 Bacteria 3110
85 Ga0495594_0000012 3300046499 Bacteria 105133
86 Ga0495606_0000895 3300046507 Bacteria 44393
87 Ga0495608_0026289 3300046511 Bacteria 3969
88 Ga0495628_0091919 3300046516 Bacteria 2348
89 Ga0495630_0000032 3300046517 Bacteria 134425
90 Ga0495652_0000018 3300046529 Bacteria 201634
91 Ga0495652_0041056 3300046529 Bacteria 3995
92 Ga0495621_0002341 3300046539 Bacteria 5091
93 Ga0495622_0000578 3300046557 Bacteria 21905
94 Ga0495625_0000395 3300046660 Bacteria 66640
95 Ga0495588_0000266 3300046674 Bacteria 40474
96 Ga0495647_0003765 3300046681 Bacteria 4878
97 Ga0495647_0028485 3300046681 Bacteria 2060
98 Ga0495669_0019050 3300046684 Bacteria 2959
99 Ga0495613_0088619 3300046689 Bacteria 2242
100 Ga0495670_0003379 3300046691 Bacteria 7851
101 Ga0495674_0000039 3300047319 Bacteria 97645
102 Ga0495676_0017892 3300047321 Bacteria 6255
103 Ga0495680_0060083 3300047322 Bacteria 2932
104 Ga0495686_0059626 3300047472 Unclassified 2375
105 Ga0496100_0000001 3300048903 Bacteria 530179
106 Ga0496101_0000028 3300048904 Bacteria 198664
107 Ga0496102_0000129 3300048905 Bacteria 104478
108 Ga0496102_0025877 3300048905 Bacteria 5227
109 Ga0496103_0000087 3300048906 Bacteria 104566
110 Ga0496103_0037063 3300048906 Bacteria 2988
111 Ga0496106_0003626 3300048909 Bacteria 11519
112 Ga0496107_0002003 3300048910 Bacteria 12994
113 Ga0496108_0008572 3300048911 Bacteria 8290
114 Ga0496108_0037870 3300048911 Bacteria 4018
115 Ga0496109_0000011 3300048912 Bacteria 234908
116 Ga0496109_0000589 3300048912 Bacteria 30428
117 Ga0496110_0000185 3300048913 Bacteria 39094
118 Ga0496111_0000103 3300048914 Bacteria 36804
119 Ga0496112_0000026 3300048915 Bacteria 144758
120 Ga0496113_0074020 3300048916 Unclassified 2596
121 Ga0496114_0000003 3300048917 Bacteria 630981
122 Ga0496115_0000027 3300048918 Bacteria 145505
123 Ga0496116_0000120 3300048919 Bacteria 166804
124 Ga0496117_0029648 3300048920 Bacteria 4214
125 Ga0496118_0020242 3300048921 Bacteria 5908
126 Ga0496119_0026820 3300048922 Bacteria 3982
127 Ga0496120_0004697 3300048923 Bacteria 11270
128 Ga0501047_0067101 3300049581 Bacteria 3458
129 Ga0501070_0011298 3300049586 Bacteria 7544
130 Ga0501072_0208856 3300049588 Bacteria 1556
131 Ga0501075_0001931 3300049591 Bacteria 13671
132 nmdc:mga0a205_281_c1 3300050515 Bacteria 37267
133 Ga0495612_0009442 3300053078 Bacteria 3957
134 Ga0495655_0000010 3300053083 Bacteria 125615
135 Ga0495619_0000001 3300053085 Bacteria 586054
136 Ga0495619_0000067 3300053085 Bacteria 83418
137 Ga0500566_0002787 3300053094 Bacteria 10417
138 Ga0500628_000024 3300053129 Bacteria 64538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0208856 Ga0501072_0208856_47_1321 386
2 3300048920 Ga0496117_0029648 Ga0496117_0029648_3006_4199 397
3 3300031995 Ga0307409_100171976 Ga0307409_1001719761 417
4 3300046689 Ga0495613_0088619 Ga0495613_0088619_196_1602 441
5 3300044842 Ga0466957_0041970 Ga0466957_0041970_433_1761 442
6 3300046684 Ga0495669_0019050 Ga0495669_0019050_752_2155 444
7 3300048916 Ga0496113_0074020 Ga0496113_0074020_406_1809 444
8 3300009176 Ga0105242_10044299 Ga0105242_100442992 446
9 3300025934 Ga0207686_10010369 Ga0207686_100103692 446
10 3300046681 Ga0495647_0028485 Ga0495647_0028485_139_1542 446
11 3300013104 Ga0157370_10003677 Ga0157370_100036774 447
12 3300013297 Ga0157378_10039099 Ga0157378_100390995 447
13 3300050515 nmdc:mga0a205_281_c1 nmdc:mga0a205_281_c1_2516_3955 447
14 3300005842 Ga0068858_100000017 Ga0068858_100000017174 448
15 3300026035 Ga0207703_10000030 Ga0207703_10000030170 448
16 3300048911 Ga0496108_0037870 Ga0496108_0037870_906_2303 448
17 3300048912 Ga0496109_0000589 Ga0496109_0000589_22863_24260 448
18 3300005338 Ga0068868_100000104 Ga0068868_10000010411 449
19 3300026023 Ga0207677_10000639 Ga0207677_100006394 449
20 3300047472 Ga0495686_0059626 Ga0495686_0059626_693_2087 449
21 3300053085 Ga0495619_0000001 Ga0495619_0000001_350142_351548 451
22 3300025986 Ga0207658_10237682 Ga0207658_102376822 452
23 3300046557 Ga0495622_0000578 Ga0495622_0000578_5894_7297 452
24 3300005356 Ga0070674_100000030 Ga0070674_10000003010 456
25 3300005718 Ga0068866_10000130 Ga0068866_100001307 456
26 3300009148 Ga0105243_10037862 Ga0105243_100378623 456
27 3300009176 Ga0105242_10098837 Ga0105242_100988372 456
28 3300025899 Ga0207642_10000047 Ga0207642_100000477 456
29 3300025937 Ga0207669_10000029 Ga0207669_1000002938 456
30 3300013308 Ga0157375_10003402 Ga0157375_1000340211 457
31 3300005439 Ga0070711_100016591 Ga0070711_1000165915 460
32 3300025915 Ga0207693_10001233 Ga0207693_100012336 460
33 3300025916 Ga0207663_10001354 Ga0207663_100013545 460
34 3300048911 Ga0496108_0008572 Ga0496108_0008572_2498_3880 460
35 3300048912 Ga0496109_0000011 Ga0496109_0000011_30052_31434 460
36 3300005344 Ga0070661_100000110 Ga0070661_10000011030 461
37 3300005365 Ga0070688_100000053 Ga0070688_1000000534 461
38 3300005535 Ga0070684_100050545 Ga0070684_1000505453 461
39 3300005543 Ga0070672_100000005 Ga0070672_10000000570 461
40 3300005548 Ga0070665_100016069 Ga0070665_1000160694 461
41 3300013297 Ga0157378_10013905 Ga0157378_100139054 461
42 3300013308 Ga0157375_10443638 Ga0157375_104436381 461
43 3300014326 Ga0157380_10000186 Ga0157380_1000018628 461
44 3300025920 Ga0207649_10000015 Ga0207649_10000015212 461
45 3300025926 Ga0207659_10000707 Ga0207659_100007073 461
46 3300025940 Ga0207691_10000028 Ga0207691_1000002860 461
47 3300025944 Ga0207661_10052985 Ga0207661_100529854 461
48 3300025945 Ga0207679_10050318 Ga0207679_100503184 461
49 3300026023 Ga0207677_10004707 Ga0207677_100047078 461
50 3300028379 Ga0268266_10019755 Ga0268266_100197554 461
51 3300032126 Ga0307415_100002865 Ga0307415_1000028655 461
52 3300046459 Ga0495629_0000899 Ga0495629_0000899_6376_7764 462
53 3300005457 Ga0070662_100000001 Ga0070662_100000001168 463
54 3300005466 Ga0070685_10000032 Ga0070685_100000324 463
55 3300005614 Ga0068856_100020021 Ga0068856_1000200216 463
56 3300005616 Ga0068852_100000037 Ga0068852_10000003759 463
57 3300009098 Ga0105245_10000303 Ga0105245_100003034 463
58 3300009101 Ga0105247_10027723 Ga0105247_100277234 463
59 3300009177 Ga0105248_10000017 Ga0105248_10000017245 463
60 3300013105 Ga0157369_10000105 Ga0157369_1000010553 463
61 3300025927 Ga0207687_10000040 Ga0207687_1000004077 463
62 3300025933 Ga0207706_10000003 Ga0207706_10000003163 463
63 3300025941 Ga0207711_10000011 Ga0207711_10000011292 463
64 3300026078 Ga0207702_10000690 Ga0207702_100006904 463
65 3300026142 Ga0207698_10000015 Ga0207698_10000015181 463
66 3300046507 Ga0495606_0000895 Ga0495606_0000895_17905_19299 463
67 3300046517 Ga0495630_0000032 Ga0495630_0000032_572_1966 463
68 3300046674 Ga0495588_0000266 Ga0495588_0000266_33051_34445 463
69 3300046681 Ga0495647_0003765 Ga0495647_0003765_3028_4422 463
70 3300048913 Ga0496110_0000185 Ga0496110_0000185_21668_23059 463
71 3300048914 Ga0496111_0000103 Ga0496111_0000103_30323_31714 463
72 3300053085 Ga0495619_0000067 Ga0495619_0000067_25226_26617 463
73 3300005341 Ga0070691_10000013 Ga0070691_100000139 464
74 3300005341 Ga0070691_10006436 Ga0070691_100064363 464
75 3300005436 Ga0070713_100000023 Ga0070713_10000002398 464
76 3300005618 Ga0068864_100000043 Ga0068864_10000004397 464
77 3300005983 Ga0081540_1000106 Ga0081540_100010630 464
78 3300006881 Ga0068865_100000081 Ga0068865_10000008151 464
79 3300009101 Ga0105247_10000148 Ga0105247_1000014854 464
80 3300009176 Ga0105242_10000052 Ga0105242_1000005242 464
81 3300013297 Ga0157378_10112189 Ga0157378_101121893 464
82 3300013308 Ga0157375_10018573 Ga0157375_100185736 464
83 3300025900 Ga0207710_10000336 Ga0207710_1000033625 464
84 3300025925 Ga0207650_10042580 Ga0207650_100425803 464
85 3300025928 Ga0207700_10000003 Ga0207700_1000000398 464
86 3300025934 Ga0207686_10000119 Ga0207686_1000011928 464
87 3300025938 Ga0207704_10000018 Ga0207704_1000001895 464
88 3300026075 Ga0207708_10043280 Ga0207708_100432803 464
89 3300026095 Ga0207676_10000042 Ga0207676_1000004270 464
90 3300026121 Ga0207683_10035899 Ga0207683_100358996 464
91 3300046459 Ga0495629_0044657 Ga0495629_0044657_944_2338 464
92 3300046529 Ga0495652_0000018 Ga0495652_0000018_164344_165747 464
93 3300046660 Ga0495625_0000395 Ga0495625_0000395_62720_64114 464
94 3300046691 Ga0495670_0003379 Ga0495670_0003379_4286_5686 464
95 3300047321 Ga0495676_0017892 Ga0495676_0017892_4244_5638 464
96 3300047322 Ga0495680_0060083 Ga0495680_0060083_1018_2412 464
97 3300048903 Ga0496100_0000001 Ga0496100_0000001_8598_9992 464
98 3300048904 Ga0496101_0000028 Ga0496101_0000028_8587_9981 464
99 3300048905 Ga0496102_0000129 Ga0496102_0000129_46054_47448 464
100 3300048905 Ga0496102_0025877 Ga0496102_0025877_1469_2872 464
101 3300048906 Ga0496103_0000087 Ga0496103_0000087_46052_47446 464
102 3300048909 Ga0496106_0003626 Ga0496106_0003626_1531_2925 464
103 3300048910 Ga0496107_0002003 Ga0496107_0002003_1538_2932 464
104 3300048917 Ga0496114_0000003 Ga0496114_0000003_415816_417210 464
105 3300048918 Ga0496115_0000027 Ga0496115_0000027_142103_143497 464
106 3300048921 Ga0496118_0020242 Ga0496118_0020242_1470_2873 464
107 3300049591 Ga0501075_0001931 Ga0501075_0001931_183_1583 464
108 3300053078 Ga0495612_0009442 Ga0495612_0009442_2131_3525 464
109 3300053083 Ga0495655_0000010 Ga0495655_0000010_66749_68143 464
110 3300053094 Ga0500566_0002787 Ga0500566_0002787_2968_4362 464
111 3300053129 Ga0500628_000024 Ga0500628_000024_41262_42656 464
112 3300005329 Ga0070683_100006003 Ga0070683_10000600312 465
113 3300005335 Ga0070666_10018746 Ga0070666_100187466 465
114 3300005535 Ga0070684_100025844 Ga0070684_1000258445 465
115 3300005548 Ga0070665_100038262 Ga0070665_1000382626 465
116 3300005718 Ga0068866_10000005 Ga0068866_1000000581 465
117 3300005842 Ga0068858_100045052 Ga0068858_1000450525 465
118 3300005937 Ga0081455_10112038 Ga0081455_101120383 465
119 3300025899 Ga0207642_10000005 Ga0207642_10000005286 465
120 3300025903 Ga0207680_10007274 Ga0207680_100072747 465
121 3300025937 Ga0207669_10000047 Ga0207669_100000473 465
122 3300025944 Ga0207661_10018599 Ga0207661_100185993 465
123 3300025986 Ga0207658_10013436 Ga0207658_100134367 465
124 3300028379 Ga0268266_10000485 Ga0268266_1000048535 465
125 3300028800 Ga0265338_10000051 Ga0265338_1000005125 465
126 3300046499 Ga0495594_0000012 Ga0495594_0000012_54314_55717 465
127 3300046511 Ga0495608_0026289 Ga0495608_0026289_1074_2471 465
128 3300046516 Ga0495628_0091919 Ga0495628_0091919_154_1557 465
129 3300046529 Ga0495652_0041056 Ga0495652_0041056_167_1570 465
130 3300046539 Ga0495621_0002341 Ga0495621_0002341_1434_2831 465
131 3300047319 Ga0495674_0000039 Ga0495674_0000039_10339_11742 465
132 3300048906 Ga0496103_0037063 Ga0496103_0037063_503_1909 465
133 3300048915 Ga0496112_0000026 Ga0496112_0000026_97132_98529 465
134 3300048919 Ga0496116_0000120 Ga0496116_0000120_105399_106805 465
135 3300048922 Ga0496119_0026820 Ga0496119_0026820_551_1957 465
136 3300048923 Ga0496120_0004697 Ga0496120_0004697_2488_3894 465
137 3300049581 Ga0501047_0067101 Ga0501047_0067101_472_1878 465
138 3300049586 Ga0501070_0011298 Ga0501070_0011298_4589_5995 465

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iyz-assembly1.cif.gz_A structure of aquaporin-4 s180d mutant at 10.0 a resolution from electron micrograph 0.2858 19 226
5goy-assembly1.cif.gz_A the crystal structure of human cytosolic methionyl-trna synthetase in complex with methionine 0.2791 261 417
3gd8-assembly1.cif.gz_A crystal structure of human aquaporin 4 at 1.8 and its mechanism of conductance 0.2746 20 226
1rsv-assembly1.cif.gz_A azide complex of the diferrous e238a mutant r2 subunit of ribonucleotide reductase 0.2628 159 402
3iyz-assembly1.cif.gz_A structure of aquaporin-4 s180d mutant at 10.0 a resolution from electron micrograph 0.2555 19 226
ID Description Score Start End Superfamily
af_Q8MMS1_490_618_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.325 266 358 1.20.140.10
af_A0A1D6MF11_37_285_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3235 60 229 1.20.1080.10
af_A0A0R4IKR8_772_977_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3206 259 460 1.20.1410.10
af_P34355_479_609_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.3106 267 358 1.20.140.10
af_Q9R0H0_480_611_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.3103 266 368 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A1Q3NGK6-F1-model_v4 deleted 0.9476 8 465
AF-A0A1Q3ND22-F1-model_v4 deleted 0.9411 164 465
AF-A0A6I2YA95-F1-model_v4 Fenitrothion hydrolase 0.9394 12 465 GO:0016020
GO:0016787
AF-A0A1Q3NGK6-F1-model_v4 deleted 0.9376 8 465
AF-A0A538CPZ3-F1-model_v4 Fenitrothion hydrolase 0.9362 67 232 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
80.47 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map