F171193

General Info

Members Datasets Scaffolds Average Seq Length
137 103 274 408

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0038334|Ga0501036_0038334_1435_2760
Length 441
Sequence VSGLRVLLVGGGGREHALAWKLARSPKLGALYAAPGNPGIARLAECVPVRADDIAGIVDLATRERIDLTVVGPEGPLALGVVDALAARGRLAFGPTRAAAALESSKAFAKDLFDRHGIPTARFQTFDDPAAARAFVAELGGRAVVKADGLAAGKGAVLCGDPDEAARAIHDMLERRVFGEAGARVVVEEYLDGEEVSVFALTDGRTVCPLGSAQDHKAVFDGDRGPNTGGMGAYSPAPALDGVLAEEVVRTVLEPTVRAMAAEGRPYRGVLFAGLMLTPKGMRVLEYNVRFGDPECQALMPRLADDLLPLCLAVAEGRELPRSVAWRDEAAVCVVLASGGYPGDYATGLPIEGIEQAESRPGVTVFHAGTAVRNGRLVTAGGRVLGVTALGADIPAAVDAAYAAAADIRFEGVHYRRDIGHRALRRSGPRPHRPGERDQAR

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
59 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
60 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
101 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0038334 3300049572 Bacteria 4056
2 Ga0070658_10116265 3300005327 Bacteria 2219
3 Ga0070682_100065791 3300005337 Bacteria 2305
4 Ga0070660_100041632 3300005339 Bacteria 3502
5 Ga0070692_10051946 3300005345 Bacteria 2133
6 Ga0070675_100025331 3300005354 Bacteria 4756
7 Ga0070675_100040617 3300005354 Bacteria 3798
8 Ga0070703_10001918 3300005406 Bacteria 6105
9 Ga0070714_100009354 3300005435 Bacteria 7699
10 Ga0070714_100025891 3300005435 Bacteria 4844
11 Ga0070705_100139500 3300005440 Bacteria 1593
12 Ga0070700_100060277 3300005441 Bacteria 2391
13 Ga0070708_100005398 3300005445 Bacteria 10137
14 Ga0070708_100199569 3300005445 Bacteria 1872
15 Ga0070681_10034927 3300005458 Bacteria 5049
16 Ga0070681_10210283 3300005458 Bacteria 1861
17 Ga0070699_100027669 3300005518 Bacteria 4888
18 Ga0070699_100036858 3300005518 Bacteria 4231
19 Ga0070699_100094050 3300005518 Bacteria 2623
20 Ga0070697_100105015 3300005536 Bacteria 2350
21 Ga0070695_100000253 3300005545 Bacteria 26811
22 Ga0070696_100018077 3300005546 Bacteria 4762
23 Ga0070696_100060307 3300005546 Bacteria 2653
24 Ga0068857_100030668 3300005577 Bacteria 4749
25 Ga0068859_100099280 3300005617 Bacteria 2967
26 Ga0068862_100095104 3300005844 Bacteria 2599
27 Ga0075428_100137130 3300006844 Bacteria 2660
28 Ga0097620_100099281 3300006931 Bacteria 2967
29 Ga0075435_100011586 3300007076 Bacteria 6496
30 Ga0105240_10032531 3300009093 Bacteria 6752
31 Ga0111539_10036833 3300009094 Bacteria 5911
32 Ga0114129_10042444 3300009147 Bacteria 6405
33 Ga0114129_10351639 3300009147 Bacteria 1952
34 Ga0105249_10017308 3300009553 Bacteria 6399
35 Ga0157369_10014301 3300013105 Bacteria 8965
36 Ga0157372_10257788 3300013307 Bacteria 2025
37 Ga0157372_10362826 3300013307 Bacteria 1688
38 Ga0157380_10169330 3300014326 Bacteria 1907
39 Ga0157380_10316001 3300014326 Bacteria 1446
40 Ga0157379_10127274 3300014968 Bacteria 2292
41 Ga0207643_10033980 3300025908 Bacteria 2855
42 Ga0207705_10047481 3300025909 Bacteria 3087
43 Ga0207707_10019956 3300025912 Bacteria 5849
44 Ga0207695_10131710 3300025913 Bacteria 2458
45 Ga0207660_10068073 3300025917 Bacteria 2581
46 Ga0207662_10043789 3300025918 Bacteria 2641
47 Ga0207659_10139646 3300025926 Bacteria 1880
48 Ga0207664_10004888 3300025929 Bacteria 9110
49 Ga0207664_10031981 3300025929 Bacteria 4030
50 Ga0207706_10035877 3300025933 Bacteria 4406
51 Ga0207669_10103084 3300025937 Bacteria 1892
52 Ga0207668_10009891 3300025972 Bacteria 5733
53 Ga0207708_10209572 3300026075 Bacteria 1557
54 Ga0207674_10042921 3300026116 Bacteria 4666
55 Ga0207675_100111682 3300026118 Bacteria 2579
56 Ga0268265_10081811 3300028380 Bacteria 2551
57 Ga0268265_10107669 3300028380 Bacteria 2267
58 Ga0268264_10025972 3300028381 Bacteria 4782
59 Ga0265338_10157035 3300028800 Bacteria 1761
60 Ga0265327_10006695 3300031251 Bacteria 9128
61 Ga0307416_100023229 3300032002 Bacteria 4495
62 Ga0307415_100022459 3300032126 Bacteria 3894
63 Ga0395899_0008143 3300037312 Bacteria 8076
64 Ga0395900_0003117 3300037418 Bacteria 17997
65 Ga0395900_0128091 3300037418 Bacteria 2602
66 Ga0395900_0414786 3300037418 Bacteria 1308
67 Ga0395898_0126131 3300037466 Bacteria 2452
68 Ga0395898_0148114 3300037466 Bacteria 2247
69 Ga0395905_0003388 3300037471 Bacteria 17063
70 Ga0395905_0036251 3300037471 Bacteria 4632
71 Ga0395905_0113929 3300037471 Bacteria 2541
72 Ga0395901_0005195 3300038443 Bacteria 13142
73 Ga0395901_0143996 3300038443 Bacteria 2505
74 Ga0436360_0126182 3300039438 Bacteria 5220
75 Ga0439439_0001672 3300041406 Bacteria 4499
76 Ga0439466_0034410 3300041411 Bacteria 1718
77 Ga0439433_0004004 3300041999 Bacteria 3169
78 Ga0439462_0007382 3300042015 Bacteria 2752
79 Ga0439446_0006135 3300042156 Bacteria 3121
80 Ga0439434_0001214 3300042435 Bacteria 7415
81 Ga0451577_0039528 3300042876 Bacteria 4239
82 Ga0466963_0001327 3300044694 Bacteria 13181
83 Ga0466963_0055875 3300044694 Bacteria 2626
84 Ga0466963_0061689 3300044694 Bacteria 2507
85 Ga0466957_0018560 3300044842 Bacteria 4086
86 Ga0466960_0006830 3300044901 Bacteria 4600
87 Ga0466960_0016905 3300044901 Bacteria 3172
88 Ga0466967_0001136 3300045976 Bacteria 14841
89 Ga0466967_0153300 3300045976 Bacteria 2156
90 Ga0466967_0336934 3300045976 Bacteria 1458
91 Ga0495605_0049348 3300046474 Bacteria 2057
92 Ga0495607_0026009 3300046501 Bacteria 3634
93 Ga0495628_0003309 3300046516 Bacteria 14411
94 Ga0495628_0010123 3300046516 Bacteria 8019
95 Ga0495630_0019879 3300046517 Bacteria 4944
96 Ga0495640_0028319 3300046533 Bacteria 4035
97 Ga0495645_0041724 3300046543 Bacteria 3346
98 Ga0495633_0114198 3300046558 Bacteria 1252
99 Ga0495658_0014163 3300046683 Bacteria 4068
100 Ga0495613_0159962 3300046689 Bacteria 1603
101 Ga0495600_0162225 3300046809 Bacteria 1445
102 Ga0495674_0065258 3300047319 Bacteria 3163
103 Ga0496100_0025631 3300048903 Bacteria 3608
104 Ga0496101_0003996 3300048904 Bacteria 9226
105 Ga0496102_0037367 3300048905 Bacteria 4380
106 Ga0496106_0010080 3300048909 Bacteria 6979
107 Ga0501036_0118551 3300049572 Bacteria 2235
108 Ga0501039_0124734 3300049575 Bacteria 2020
109 Ga0501040_0008547 3300049576 Bacteria 6645
110 Ga0501041_0049536 3300049577 Bacteria 2559
111 Ga0501041_0053602 3300049577 Bacteria 2460
112 Ga0501042_0007964 3300049578 Bacteria 6972
113 Ga0501043_0064823 3300049579 Bacteria 2869
114 Ga0501046_0012805 3300049580 Bacteria 7135
115 Ga0501047_0017646 3300049581 Bacteria 6838
116 Ga0501067_0126123 3300049583 Bacteria 1424
117 Ga0501072_0002552 3300049588 Bacteria 13647
118 Ga0501072_0003979 3300049588 Bacteria 11179
119 Ga0501072_0008530 3300049588 Bacteria 7773
120 Ga0501073_0025730 3300049589 Bacteria 4217
121 Ga0501075_0016567 3300049591 Bacteria 5312
122 Ga0501076_0035762 3300049592 Bacteria 3886
123 Ga0501249_001892 3300049679 Bacteria 4255
124 Ga0501079_0005150 3300049741 Bacteria 9717
125 Ga0501079_0072574 3300049741 Bacteria 2660
126 Ga0501080_0013313 3300049742 Bacteria 7559
127 Ga0501080_0156595 3300049742 Bacteria 2104
128 Ga0501045_0002465 3300049824 Bacteria 12573
129 Ga0501045_0029501 3300049824 Bacteria 3965
130 nmdc:mga0rr50_5367_c1 3300050513 Bacteria 7637
131 nmdc:mga0rr50_86138_c1 3300050513 Bacteria 2436
132 Ga0495601_0020593 3300053077 Bacteria 4030
133 Ga0495595_0004947 3300053084 Bacteria 5372
134 Ga0501084_0005583 3300054114 Bacteria 10327
135 Ga0501082_0021253 3300060353 Bacteria 5598
136 Ga0501082_0288738 3300060353 Bacteria 1428
137 Ga0501082_0387630 3300060353 Bacteria 1219
138 Ga0501036_0038334
139 Ga0070658_10116265
140 Ga0070682_100065791
141 Ga0070660_100041632
142 Ga0070692_10051946
143 Ga0070675_100025331
144 Ga0070675_100040617
145 Ga0070703_10001918
146 Ga0070714_100009354
147 Ga0070714_100025891
148 Ga0070705_100139500
149 Ga0070700_100060277
150 Ga0070708_100005398
151 Ga0070708_100199569
152 Ga0070681_10034927
153 Ga0070681_10210283
154 Ga0070699_100027669
155 Ga0070699_100036858
156 Ga0070699_100094050
157 Ga0070697_100105015
158 Ga0070695_100000253
159 Ga0070696_100018077
160 Ga0070696_100060307
161 Ga0068857_100030668
162 Ga0068859_100099280
163 Ga0068862_100095104
164 Ga0075428_100137130
165 Ga0097620_100099281
166 Ga0075435_100011586
167 Ga0105240_10032531
168 Ga0111539_10036833
169 Ga0114129_10042444
170 Ga0114129_10351639
171 Ga0105249_10017308
172 Ga0157369_10014301
173 Ga0157372_10257788
174 Ga0157372_10362826
175 Ga0157380_10169330
176 Ga0157380_10316001
177 Ga0157379_10127274
178 Ga0207643_10033980
179 Ga0207705_10047481
180 Ga0207707_10019956
181 Ga0207695_10131710
182 Ga0207660_10068073
183 Ga0207662_10043789
184 Ga0207659_10139646
185 Ga0207664_10004888
186 Ga0207664_10031981
187 Ga0207706_10035877
188 Ga0207669_10103084
189 Ga0207668_10009891
190 Ga0207708_10209572
191 Ga0207674_10042921
192 Ga0207675_100111682
193 Ga0268265_10081811
194 Ga0268265_10107669
195 Ga0268264_10025972
196 Ga0265338_10157035
197 Ga0265327_10006695
198 Ga0307416_100023229
199 Ga0307415_100022459
200 Ga0395899_0008143
201 Ga0395900_0003117
202 Ga0395900_0128091
203 Ga0395900_0414786
204 Ga0395898_0126131
205 Ga0395898_0148114
206 Ga0395905_0003388
207 Ga0395905_0036251
208 Ga0395905_0113929
209 Ga0395901_0005195
210 Ga0395901_0143996
211 Ga0436360_0126182
212 Ga0439439_0001672
213 Ga0439466_0034410
214 Ga0439433_0004004
215 Ga0439462_0007382
216 Ga0439446_0006135
217 Ga0439434_0001214
218 Ga0451577_0039528
219 Ga0466963_0001327
220 Ga0466963_0055875
221 Ga0466963_0061689
222 Ga0466957_0018560
223 Ga0466960_0006830
224 Ga0466960_0016905
225 Ga0466967_0001136
226 Ga0466967_0153300
227 Ga0466967_0336934
228 Ga0495605_0049348
229 Ga0495607_0026009
230 Ga0495628_0003309
231 Ga0495628_0010123
232 Ga0495630_0019879
233 Ga0495640_0028319
234 Ga0495645_0041724
235 Ga0495633_0114198
236 Ga0495658_0014163
237 Ga0495613_0159962
238 Ga0495600_0162225
239 Ga0495674_0065258
240 Ga0496100_0025631
241 Ga0496101_0003996
242 Ga0496102_0037367
243 Ga0496106_0010080
244 Ga0501036_0118551
245 Ga0501039_0124734
246 Ga0501040_0008547
247 Ga0501041_0049536
248 Ga0501041_0053602
249 Ga0501042_0007964
250 Ga0501043_0064823
251 Ga0501046_0012805
252 Ga0501047_0017646
253 Ga0501067_0126123
254 Ga0501072_0002552
255 Ga0501072_0003979
256 Ga0501072_0008530
257 Ga0501073_0025730
258 Ga0501075_0016567
259 Ga0501076_0035762
260 Ga0501249_001892
261 Ga0501079_0005150
262 Ga0501079_0072574
263 Ga0501080_0013313
264 Ga0501080_0156595
265 Ga0501045_0002465
266 Ga0501045_0029501
267 nmdc:mga0rr50_5367_c1
268 nmdc:mga0rr50_86138_c1
269 Ga0495601_0020593
270 Ga0495595_0004947
271 Ga0501084_0005583
272 Ga0501082_0021253
273 Ga0501082_0288738
274 Ga0501082_0387630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

104

296

1

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

4

103

0.99

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

331

422

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9501 3 388
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9484 1 387
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9437 1 387
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.943 3 388
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9404 1 387
ID Description Score Start End Superfamily
af_P22102_333_434_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9773 298 384 3.90.600.10
af_C0PFX3_419_522_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9615 300 386 3.90.600.10
5vevB04 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9605 298 387 3.90.600.10
1vkzB04 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9581 300 385 3.90.600.10
af_P9WHM9_2_93_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9532 2 90 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A3B9F6K8-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.988 298 384 GO:0000166
GO:0004637
GO:0009113
AF-A0A7W0UFN3-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) 0.9834 1 287 GO:0004637
GO:0005524
GO:0009113
GO:0046872
AF-A0A7W1S1H8-F1-model_v4 deleted 0.9825 296 387
AF-A0A1V6FYR4-F1-model_v4 deleted 0.9816 292 387
AF-A0A7V8NXD4-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9798 304 387 GO:0000166
GO:0004637
GO:0009113

Map