F170662

General Info

Members Datasets Scaffolds Average Seq Length
137 92 137 453

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_0154416|Ga0451837_0154416_121_1581
Length 486
Sequence MAKFRLNRRAVLRGAGSVAIALPWLEIMGDPAHAQSAATAAKRFLAVYTPGGAVIDDGSGKNKWRPTGTETAPVLSSILAPLQPMMEKKKLLIVDGLDMLSKNGEQHQAGIIAWMTGTAQLQAPANGGLPGTNSYASGPSIDQTIATRISAGKKKIASLEMAVRWGTGKAHGLLSPISCANFEDNLKASPIAPRIDPQQIFKDLFGSLTTTTADPAEAAALERQKSILDNVRGQYESLMPKLGTGDRATLQQHLDKVRELEMGLSAVQMGSTACKAPMKVDTAGYNPGTGMCGSNCGAADTGANKDIATDSKIPLVGTFMMDMMVMALACDLTGVGTFQWTDTEAKHTFPWLNLPEHHHFYQHDGGFKAAECEKINIWYSQMHLHLLQQMDGIVMGADGHTLLDESVVFFGSEISQPPTHSNKDMPFMLAGGXXXLRGGRWVRYTEKSNNKNSHNNLLVSIANLFGDTRTTYGNPAFCSGPLANIT

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 2.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 5.84
Rhizosphere 83.21
Stem 0
Stem Tuber 0
Unclassified 9.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1013947 3300003163 Bacteria 3929
2 Ga0006759J45824_1057015 3300003163 Unclassified 2893
3 rootH1_10031370 3300003323 Bacteria 6741
4 rootH1_10034599 3300003323 Bacteria 4759
5 rootH1_10073853 3300003323 Bacteria 7601
6 rootH1_10165950 3300003323 Bacteria 6665
7 rootH1_10180870 3300003323 Bacteria 4533
8 rootH1_10312032 3300003323 Bacteria 4631
9 rootH1_10376573 3300003323 Bacteria 3354
10 Ga0032354_1009527 3300003693 Bacteria 3854
11 Ga0070683_100014391 3300005329 Bacteria 6919
12 Ga0070682_100004463 3300005337 Bacteria 7770
13 Ga0070682_100009647 3300005337 Bacteria 5464
14 Ga0068868_100045463 3300005338 Bacteria 3435
15 Ga0070689_100000004 3300005340 Bacteria 497771
16 Ga0070689_100000006 3300005340 Bacteria 332562
17 Ga0070689_100011159 3300005340 Bacteria 6428
18 Ga0070689_100034035 3300005340 Bacteria 3886
19 Ga0070691_10035826 3300005341 Bacteria 2338
20 Ga0070687_100009580 3300005343 Bacteria 4157
21 Ga0070668_100044678 3300005347 Unclassified 3398
22 Ga0070669_100015890 3300005353 Bacteria 5370
23 Ga0070671_100013559 3300005355 Bacteria 6572
24 Ga0070673_100000464 3300005364 Bacteria 21543
25 Ga0070688_100003435 3300005365 Bacteria 8146
26 Ga0070700_100007107 3300005441 Bacteria 6022
27 Ga0068867_100062535 3300005459 Bacteria 2766
28 Ga0070685_10029803 3300005466 Bacteria 3035
29 Ga0070706_100097407 3300005467 Bacteria 2732
30 Ga0070684_100003968 3300005535 Bacteria 11209
31 Ga0068853_100001516 3300005539 Bacteria 16884
32 Ga0068853_100004739 3300005539 Bacteria 10566
33 Ga0070672_100000782 3300005543 Bacteria 18943
34 Ga0070672_100043739 3300005543 Bacteria 3456
35 Ga0068855_100000012 3300005563 Bacteria 237166
36 Ga0068855_100000084 3300005563 Bacteria 112321
37 Ga0068855_100000102 3300005563 Bacteria 105073
38 Ga0068855_100001136 3300005563 Bacteria 32989
39 Ga0068855_100003288 3300005563 Bacteria 19792
40 Ga0068855_100054128 3300005563 Unclassified 4717
41 Ga0068856_100011658 3300005614 Bacteria 8528
42 Ga0068856_100039105 3300005614 Unclassified 4658
43 Ga0068856_100193889 3300005614 Unclassified 2046
44 Ga0068852_100028732 3300005616 Bacteria 4557
45 Ga0068859_100002845 3300005617 Bacteria 17551
46 Ga0068864_100055177 3300005618 Unclassified 3430
47 Ga0068864_100239996 3300005618 Bacteria 1679
48 Ga0068861_100010590 3300005719 Bacteria 6402
49 Ga0068861_100028987 3300005719 Unclassified 4043
50 Ga0068861_100078184 3300005719 Unclassified 2583
51 Ga0068862_100012713 3300005844 Bacteria 6966
52 Ga0075366_10006709 3300006195 Bacteria 6320
53 Ga0068865_100007351 3300006881 Bacteria 6773
54 Ga0068865_100128744 3300006881 Bacteria 1894
55 Ga0097620_100002845 3300006931 Bacteria 17551
56 Ga0075435_100008542 3300007076 Bacteria 7359
57 Ga0111539_10009508 3300009094 Bacteria 12270
58 Ga0105238_10004481 3300009551 Bacteria 13843
59 Ga0105238_10013884 3300009551 Bacteria 8145
60 Ga0157375_10092303 3300013308 Bacteria 3091
61 Ga0207645_10006633 3300025907 Bacteria 8271
62 Ga0207681_10001573 3300025923 Bacteria 14675
63 Ga0207694_10006050 3300025924 Bacteria 9259
64 Ga0207694_10075503 3300025924 Bacteria 2638
65 Ga0207706_10033407 3300025933 Unclassified 4580
66 Ga0207670_10000003 3300025936 Bacteria 760449
67 Ga0207670_10000007 3300025936 Bacteria 376171
68 Ga0207670_10001320 3300025936 Bacteria 13097
69 Ga0207670_10020720 3300025936 Bacteria 4044
70 Ga0207669_10019568 3300025937 Bacteria 3528
71 Ga0207704_10001442 3300025938 Bacteria 10634
72 Ga0207691_10001745 3300025940 Bacteria 21430
73 Ga0207691_10057543 3300025940 Bacteria 3538
74 Ga0207691_10069736 3300025940 Bacteria 3175
75 Ga0207689_10031282 3300025942 Unclassified 4432
76 Ga0207661_10002920 3300025944 Bacteria 11809
77 Ga0207661_10191620 3300025944 Bacteria 1793
78 Ga0207667_10000126 3300025949 Bacteria 118084
79 Ga0207667_10001496 3300025949 Bacteria 29329
80 Ga0207667_10001559 3300025949 Bacteria 28857
81 Ga0207667_10001976 3300025949 Bacteria 25689
82 Ga0207667_10002565 3300025949 Bacteria 22604
83 Ga0207651_10114764 3300025960 Bacteria 2029
84 Ga0207712_10031005 3300025961 Unclassified 3598
85 Ga0207658_10057451 3300025986 Bacteria 2892
86 Ga0207677_10046157 3300026023 Bacteria 2915
87 Ga0207639_10004095 3300026041 Bacteria 9830
88 Ga0207639_10014860 3300026041 Bacteria 5483
89 Ga0207708_10008119 3300026075 Bacteria 7773
90 Ga0207702_10087601 3300026078 Bacteria 2718
91 Ga0207702_10132388 3300026078 Unclassified 2245
92 Ga0207648_10006345 3300026089 Bacteria 11759
93 Ga0207676_10091692 3300026095 Unclassified 2497
94 Ga0207675_100005562 3300026118 Bacteria 12060
95 Ga0207675_100019041 3300026118 Bacteria 6408
96 Ga0207675_100076198 3300026118 Bacteria 3141
97 Ga0207683_10057627 3300026121 Bacteria 3410
98 Ga0207698_10016926 3300026142 Bacteria 4931
99 Ga0207428_10012283 3300027907 Bacteria 7528
100 Ga0268265_10046513 3300028380 Unclassified 3244
101 Ga0268264_10030960 3300028381 Bacteria 4387
102 Ga0265318_10000241 3300028577 Bacteria 47732
103 Ga0265330_10002979 3300031235 Bacteria 9013
104 Ga0265332_10001081 3300031238 Bacteria 15933
105 Ga0265328_10000509 3300031239 Bacteria 18009
106 Ga0265329_10000696 3300031242 Bacteria 17188
107 Ga0265331_10015849 3300031250 Bacteria 3968
108 Ga0265316_10012745 3300031344 Bacteria 7513
109 Ga0307508_10001975 3300031616 Bacteria 22399
110 Ga0265314_10020880 3300031711 Bacteria 5048
111 Ga0265342_10026340 3300031712 Bacteria 3644
112 Ga0307516_10011127 3300031730 Bacteria 9819
113 Ga0451791_0052547 3300041451 Unclassified 1923
114 Ga0451797_1510086 3300041453 Bacteria 3737
115 Ga0451807_0026890 3300041486 Bacteria 5085
116 Ga0451807_0057409 3300041486 Bacteria 7000
117 Ga0451807_0941402 3300041486 Bacteria 3362
118 Ga0451837_0154416 3300041494 Unclassified 2213
119 Ga0451837_0457892 3300041494 Bacteria 2336
120 Ga0451843_0235098 3300041509 Bacteria 1694
121 Ga0451853_3565299 3300041512 Bacteria 1552
122 Ga0466965_0014672 3300044683 Unclassified 3710
123 Ga0496100_0078414 3300048903 Bacteria 2223
124 Ga0496108_0014532 3300048911 Bacteria 6428
125 Ga0496114_0000326 3300048917 Bacteria 34863
126 Ga0501312_004395 3300049528 Bacteria 1659
127 Ga0501047_0030119 3300049581 Bacteria 5233
128 Ga0501067_0000949 3300049583 Bacteria 15523
129 Ga0501067_0017235 3300049583 Bacteria 3992
130 Ga0501071_0052954 3300049587 Bacteria 2927
131 Ga0501073_0000033 3300049589 Bacteria 99649
132 Ga0501080_0192298 3300049742 Bacteria 1875
133 nmdc:mga0k408_18524_c1 3300050493 Bacteria 3887
134 nmdc:mga08y16_1481_c1 3300050511 Bacteria 23576
135 nmdc:mga0rr50_12705_c1 3300050513 Bacteria 5454
136 Ga0501084_0065915 3300054114 Bacteria 3030
137 Ga0501084_0087436 3300054114 Bacteria 2617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0014532 Ga0496108_0014532_3797_5137 411
2 3300007076 Ga0075435_100008542 Ga0075435_1000085427 413
3 3300050513 nmdc:mga0rr50_12705_c1 nmdc:mga0rr50_12705_c1_3817_5214 413
4 3300005563 Ga0068855_100003288 Ga0068855_10000328811 427
5 3300025949 Ga0207667_10001976 Ga0207667_100019768 427
6 3300041494 Ga0451837_0457892 Ga0451837_0457892_233_1570 427
7 3300049587 Ga0501071_0052954 Ga0501071_0052954_814_2169 428
8 3300005563 Ga0068855_100000012 Ga0068855_100000012114 430
9 3300025949 Ga0207667_10000126 Ga0207667_1000012647 430
10 3300003323 rootH1_10312032 rootH1_103120322 431
11 3300006195 Ga0075366_10006709 Ga0075366_100067092 431
12 3300050493 nmdc:mga0k408_18524_c1 nmdc:mga0k408_18524_c1_851_2245 431
13 3300003323 rootH1_10376573 rootH1_103765732 432
14 3300054114 Ga0501084_0087436 Ga0501084_0087436_1111_2538 432
15 3300005563 Ga0068855_100001136 Ga0068855_10000113613 433
16 3300005614 Ga0068856_100011658 Ga0068856_1000116583 433
17 3300025949 Ga0207667_10002565 Ga0207667_100025657 433
18 3300028577 Ga0265318_10000241 Ga0265318_100002415 433
19 3300031235 Ga0265330_10002979 Ga0265330_100029792 433
20 3300031238 Ga0265332_10001081 Ga0265332_100010812 433
21 3300031239 Ga0265328_10000509 Ga0265328_100005092 433
22 3300031242 Ga0265329_10000696 Ga0265329_1000069614 433
23 3300031250 Ga0265331_10015849 Ga0265331_100158494 433
24 3300031344 Ga0265316_10012745 Ga0265316_100127454 433
25 3300031711 Ga0265314_10020880 Ga0265314_100208802 433
26 3300031712 Ga0265342_10026340 Ga0265342_100263404 433
27 3300031730 Ga0307516_10011127 Ga0307516_100111275 434
28 3300041486 Ga0451807_0941402 Ga0451807_0941402_1484_2878 434
29 3300041512 Ga0451853_3565299 Ga0451853_3565299_57_1505 434
30 3300049581 Ga0501047_0030119 Ga0501047_0030119_71_1414 434
31 3300005563 Ga0068855_100000084 Ga0068855_10000008430 435
32 3300025949 Ga0207667_10001496 Ga0207667_1000149622 435
33 3300025986 Ga0207658_10057451 Ga0207658_100574512 435
34 3300005340 Ga0070689_100034035 Ga0070689_1000340352 436
35 3300005341 Ga0070691_10035826 Ga0070691_100358262 436
36 3300005343 Ga0070687_100009580 Ga0070687_1000095802 436
37 3300005347 Ga0070668_100044678 Ga0070668_1000446783 436
38 3300005353 Ga0070669_100015890 Ga0070669_1000158903 436
39 3300005441 Ga0070700_100007107 Ga0070700_1000071074 436
40 3300005459 Ga0068867_100062535 Ga0068867_1000625352 436
41 3300005543 Ga0070672_100043739 Ga0070672_1000437392 436
42 3300005719 Ga0068861_100028987 Ga0068861_1000289874 436
43 3300005844 Ga0068862_100012713 Ga0068862_1000127134 436
44 3300006881 Ga0068865_100007351 Ga0068865_1000073512 436
45 3300013308 Ga0157375_10092303 Ga0157375_100923032 436
46 3300025907 Ga0207645_10006633 Ga0207645_100066335 436
47 3300025923 Ga0207681_10001573 Ga0207681_100015739 436
48 3300025933 Ga0207706_10033407 Ga0207706_100334072 436
49 3300025936 Ga0207670_10020720 Ga0207670_100207202 436
50 3300025937 Ga0207669_10019568 Ga0207669_100195682 436
51 3300025938 Ga0207704_10001442 Ga0207704_100014423 436
52 3300025940 Ga0207691_10057543 Ga0207691_100575433 436
53 3300025942 Ga0207689_10031282 Ga0207689_100312822 436
54 3300025961 Ga0207712_10031005 Ga0207712_100310052 436
55 3300026075 Ga0207708_10008119 Ga0207708_100081194 436
56 3300026089 Ga0207648_10006345 Ga0207648_100063453 436
57 3300026118 Ga0207675_100019041 Ga0207675_1000190415 436
58 3300028380 Ga0268265_10046513 Ga0268265_100465132 436
59 3300028381 Ga0268264_10030960 Ga0268264_100309602 436
60 3300031616 Ga0307508_10001975 Ga0307508_1000197523 436
61 3300003323 rootH1_10073853 rootH1_100738535 437
62 3300005467 Ga0070706_100097407 Ga0070706_1000974072 437
63 3300005614 Ga0068856_100039105 Ga0068856_1000391053 437
64 3300026078 Ga0207702_10087601 Ga0207702_100876012 437
65 3300044683 Ga0466965_0014672 Ga0466965_0014672_1720_3114 437
66 3300049528 Ga0501312_004395 Ga0501312_004395_16_1407 437
67 3300005563 Ga0068855_100000102 Ga0068855_10000010273 438
68 3300005719 Ga0068861_100078184 Ga0068861_1000781842 438
69 3300025949 Ga0207667_10001559 Ga0207667_100015594 438
70 3300026118 Ga0207675_100076198 Ga0207675_1000761981 438
71 3300054114 Ga0501084_0065915 Ga0501084_0065915_894_2294 438
72 3300005340 Ga0070689_100011159 Ga0070689_1000111593 439
73 3300005355 Ga0070671_100013559 Ga0070671_1000135593 439
74 3300005364 Ga0070673_100000464 Ga0070673_1000004645 439
75 3300005365 Ga0070688_100003435 Ga0070688_1000034353 439
76 3300005466 Ga0070685_10029803 Ga0070685_100298033 439
77 3300025936 Ga0207670_10001320 Ga0207670_100013209 439
78 3300025940 Ga0207691_10069736 Ga0207691_100697362 439
79 3300025960 Ga0207651_10114764 Ga0207651_101147642 439
80 3300026121 Ga0207683_10057627 Ga0207683_100576271 439
81 3300041453 Ga0451797_1510086 Ga0451797_1510086_573_1967 439
82 3300041486 Ga0451807_0057409 Ga0451807_0057409_4062_5420 440
83 3300041509 Ga0451843_0235098 Ga0451843_0235098_169_1569 440
84 3300049742 Ga0501080_0192298 Ga0501080_0192298_353_1747 440
85 3300005618 Ga0068864_100055177 Ga0068864_1000551772 441
86 3300026095 Ga0207676_10091692 Ga0207676_100916922 441
87 3300041451 Ga0451791_0052547 Ga0451791_0052547_145_1578 441
88 3300003323 rootH1_10034599 rootH1_100345991 442
89 3300005616 Ga0068852_100028732 Ga0068852_1000287324 442
90 3300026142 Ga0207698_10016926 Ga0207698_100169264 442
91 3300041486 Ga0451807_0026890 Ga0451807_0026890_2216_3613 442
92 3300003163 Ga0006759J45824_1057015 Ga0006759J45824_10570152 443
93 3300009551 Ga0105238_10004481 Ga0105238_100044815 443
94 3300025924 Ga0207694_10006050 Ga0207694_100060505 443
95 3300003323 rootH1_10165950 rootH1_101659503 444
96 3300005340 Ga0070689_100000006 Ga0070689_100000006109 444
97 3300005719 Ga0068861_100010590 Ga0068861_1000105902 444
98 3300025936 Ga0207670_10000003 Ga0207670_10000003333 444
99 3300026118 Ga0207675_100005562 Ga0207675_1000055622 444
100 3300003323 rootH1_10031370 rootH1_100313702 445
101 3300005539 Ga0068853_100001516 Ga0068853_10000151613 445
102 3300005543 Ga0070672_100000782 Ga0070672_1000007826 445
103 3300005618 Ga0068864_100239996 Ga0068864_1002399961 445
104 3300025940 Ga0207691_10001745 Ga0207691_100017457 445
105 3300026041 Ga0207639_10014860 Ga0207639_100148602 445
106 3300005337 Ga0070682_100004463 Ga0070682_1000044634 446
107 3300005337 Ga0070682_100009647 Ga0070682_1000096472 446
108 3300003323 rootH1_10180870 rootH1_101808703 447
109 3300006881 Ga0068865_100128744 Ga0068865_1001287442 447
110 3300025944 Ga0207661_10191620 Ga0207661_101916201 448
111 3300048903 Ga0496100_0078414 Ga0496100_0078414_489_1931 449
112 3300048917 Ga0496114_0000326 Ga0496114_0000326_14197_15639 449
113 3300049583 Ga0501067_0000949 Ga0501067_0000949_4144_5565 449
114 3300049589 Ga0501073_0000033 Ga0501073_0000033_1495_2916 449
115 3300005563 Ga0068855_100054128 Ga0068855_1000541285 451
116 3300005614 Ga0068856_100193889 Ga0068856_1001938892 451
117 3300026078 Ga0207702_10132388 Ga0207702_101323882 451
118 3300041494 Ga0451837_0154416 Ga0451837_0154416_121_1581 451
119 3300005329 Ga0070683_100014391 Ga0070683_1000143913 452
120 3300005535 Ga0070684_100003968 Ga0070684_1000039687 452
121 3300009094 Ga0111539_10009508 Ga0111539_100095083 452
122 3300025944 Ga0207661_10002920 Ga0207661_100029204 452
123 3300026023 Ga0207677_10046157 Ga0207677_100461572 452
124 3300027907 Ga0207428_10012283 Ga0207428_100122834 452
125 3300050511 nmdc:mga08y16_1481_c1 nmdc:mga08y16_1481_c1_14434_15867 452
126 3300005338 Ga0068868_100045463 Ga0068868_1000454632 455
127 3300005539 Ga0068853_100004739 Ga0068853_1000047393 457
128 3300026041 Ga0207639_10004095 Ga0207639_100040955 457
129 3300049583 Ga0501067_0017235 Ga0501067_0017235_811_2223 457
130 3300005617 Ga0068859_100002845 Ga0068859_10000284513 458
131 3300006931 Ga0097620_100002845 Ga0097620_1000028454 458
132 3300009551 Ga0105238_10013884 Ga0105238_100138841 458
133 3300025924 Ga0207694_10075503 Ga0207694_100755032 458
134 3300005340 Ga0070689_100000004 Ga0070689_100000004151 459
135 3300025936 Ga0207670_10000007 Ga0207670_10000007111 459
136 3300003163 Ga0006759J45824_1013947 Ga0006759J45824_10139472 466
137 3300003693 Ga0032354_1009527 Ga0032354_10095272 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07586

HXXSHH

Protein of unknown function (DUF1552)

43

383

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c01-assembly1.cif.gz_A human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c) 0.7386 306 394
6c02-assembly2.cif.gz_B human ectonucleotide pyrophosphatase / phosphodiesterase 3 (enpp3, npp3, cd203c), inactive (t205a), n594s, with alpha,beta-methylene-atp (ampcpp) 0.731 306 394
5ijs-assembly1.cif.gz_A crystal structure of autotaxin with orthovanadate bound as a trigonal bipyramidal intermediate analog 0.7142 307 394
5gz4-assembly1.cif.gz_A crystal structure of snake venom phosphodiesterase (pde) from taiwan cobra (naja atra atra) 0.709 299 394
4zg9-assembly2.cif.gz_B structural basis for inhibition of human autotaxin by four novel compounds 0.6992 305 394
ID Description Score Start End Superfamily
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7078 306 394 3.40.720.10
5udyA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6885 300 443 3.40.720.10
af_Q9US10_372_490_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6855 304 330 3.40.50.1820
2gsnB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.651 302 451 3.40.720.10
4gtyB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6373 310 394 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A358EER5-F1-model_v4 DUF1552 domain-containing protein 0.912 302 451
AF-A0A3N5GB64-F1-model_v4 DUF1552 domain-containing protein 0.9104 302 443
AF-A0A2V8H4H0-F1-model_v4 DUF1552 domain-containing protein 0.9079 309 451
AF-A0A7C3QIT7-F1-model_v4 DUF1552 domain-containing protein 0.9064 306 451
AF-A0A7C7WHW4-F1-model_v4 DUF1552 domain-containing protein 0.906 312 451

Feature Viewer

pLDDT pTM Quality
79.31 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map