F170657

General Info

Members Datasets Scaffolds Average Seq Length
137 115 137 262

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2681847|Ga0451807_2681847_469_1398
Length 309
Sequence MGLIAGARLQKHGPGRLGHFGAEPQEGAFHLIMTTRQLPLIGGHPNHLGGTLRSDTWWVGPLVTFTVFSGFIVYTTWAIFQSGYYYAEPYLSPLYAPVLFAKADALGGVPVDHAWFGEFPSWWPDLWFMPASPALLILPFPGLFRFTCYYYRKAYYRSFVGSPPGCAVSPGQRPKYWGETRFLLFQNLHRYALYFALIFVALLSYEAFCSFFKGGVFGVGVGSFMLTMNAVLIGAYTFGCHSFRHLIGGRDDCMSCGQNTVSYGAWKGASWFNARHMGFAWASLIWVVLTDIYVRLVSMGVITDLNTWS

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 1.46
Rhizosphere 93.43
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10011980 3300003320 Bacteria 2676
2 rootL2_10043640 3300003322 Bacteria 3818
3 Ga0065715_10024448 3300005293 Bacteria 2243
4 Ga0070658_10014708 3300005327 Bacteria 6276
5 Ga0070683_100247577 3300005329 Bacteria 1695
6 Ga0070683_100721318 3300005329 Bacteria 955
7 Ga0070677_10201318 3300005333 Bacteria 961
8 Ga0070682_100000418 3300005337 Bacteria 27599
9 Ga0070682_100008951 3300005337 Bacteria 5655
10 Ga0068868_100043053 3300005338 Bacteria 3527
11 Ga0068868_100308927 3300005338 Bacteria 1345
12 Ga0070660_100069628 3300005339 Bacteria 2744
13 Ga0070689_100005676 3300005340 Bacteria 8552
14 Ga0070675_100137919 3300005354 Bacteria 2083
15 Ga0070671_100131465 3300005355 Bacteria 2108
16 Ga0070659_100076200 3300005366 Bacteria 2675
17 Ga0070700_100185236 3300005441 Bacteria 1452
18 Ga0070681_10168929 3300005458 Bacteria 2109
19 Ga0070706_100077996 3300005467 Bacteria 3067
20 Ga0070707_100031171 3300005468 Bacteria 5078
21 Ga0070684_100098794 3300005535 Bacteria 2604
22 Ga0070693_100019507 3300005547 Bacteria 3556
23 Ga0070704_100111805 3300005549 Bacteria 2080
24 Ga0070704_100545182 3300005549 Bacteria 1013
25 Ga0070664_100022529 3300005564 Bacteria 5195
26 Ga0068857_100012451 3300005577 Bacteria 7406
27 Ga0068857_100581594 3300005577 Bacteria 1057
28 Ga0068859_100107991 3300005617 Bacteria 2844
29 Ga0068864_100435213 3300005618 Bacteria 1252
30 Ga0068870_10269217 3300005840 Bacteria 1063
31 Ga0075368_10143544 3300006042 Bacteria 995
32 Ga0075366_10221952 3300006195 Bacteria 1151
33 Ga0097621_100245166 3300006237 Bacteria 1567
34 Ga0097621_100400158 3300006237 Bacteria 1229
35 Ga0068871_100380612 3300006358 Bacteria 1254
36 Ga0075428_100146543 3300006844 Bacteria 2566
37 Ga0075428_100528250 3300006844 Bacteria 1262
38 Ga0075431_100075890 3300006847 Bacteria 3469
39 Ga0075431_100256145 3300006847 Bacteria 1777
40 Ga0075431_100471573 3300006847 Bacteria 1249
41 Ga0075434_100062567 3300006871 Bacteria 3705
42 Ga0097620_100107991 3300006931 Bacteria 2844
43 Ga0111539_10023491 3300009094 Bacteria 7575
44 Ga0111539_10249676 3300009094 Bacteria 2066
45 Ga0111539_10308553 3300009094 Bacteria 1841
46 Ga0114129_10925217 3300009147 Bacteria 1103
47 Ga0105248_10111559 3300009177 Bacteria 3084
48 Ga0105238_10073759 3300009551 Bacteria 3407
49 Ga0105238_10631069 3300009551 Bacteria 1081
50 Ga0105249_10054132 3300009553 Bacteria 3669
51 Ga0105239_10008625 3300010375 Bacteria 11556
52 Ga0157372_10846330 3300013307 Bacteria 1062
53 Ga0157375_10155410 3300013308 Bacteria 2426
54 Ga0163163_10414413 3300014325 Bacteria 1406
55 Ga0157380_10011769 3300014326 Bacteria 6328
56 Ga0157380_10369596 3300014326 Bacteria 1349
57 Ga0157379_10076268 3300014968 Bacteria 3002
58 Ga0157376_10513809 3300014969 Bacteria 1179
59 Ga0163161_10472902 3300017792 Bacteria 1016
60 Ga0207653_10014844 3300025885 Bacteria 2445
61 Ga0207705_10020682 3300025909 Bacteria 4700
62 Ga0207684_10012959 3300025910 Bacteria 7220
63 Ga0207657_10074704 3300025919 Bacteria 2861
64 Ga0207646_10017417 3300025922 Bacteria 6724
65 Ga0207646_10193405 3300025922 Bacteria 1837
66 Ga0207659_10083791 3300025926 Bacteria 2364
67 Ga0207670_10022519 3300025936 Bacteria 3907
68 Ga0207711_10027954 3300025941 Bacteria 4741
69 Ga0207661_10424436 3300025944 Bacteria 1208
70 Ga0207661_10603654 3300025944 Bacteria 1007
71 Ga0207712_10032453 3300025961 Bacteria 3525
72 Ga0207639_10340940 3300026041 Bacteria 1336
73 Ga0207708_10124519 3300026075 Bacteria 2011
74 Ga0207641_10036960 3300026088 Bacteria 4077
75 Ga0207648_10429310 3300026089 Bacteria 1201
76 Ga0207674_10055022 3300026116 Bacteria 4049
77 Ga0207675_100772043 3300026118 Bacteria 973
78 Ga0207683_10359255 3300026121 Bacteria 1337
79 Ga0207698_10418846 3300026142 Bacteria 1285
80 Ga0207428_10073876 3300027907 Bacteria 2674
81 Ga0268265_10624135 3300028380 Archaea 1033
82 Ga0265316_10000649 3300031344 Bacteria 38663
83 Ga0265314_10000002 3300031711 Bacteria 2092193
84 Ga0307405_10167623 3300031731 Bacteria 1563
85 Ga0307413_10081536 3300031824 Bacteria 2075
86 Ga0307410_10131661 3300031852 Bacteria 1838
87 Ga0307406_10035283 3300031901 Bacteria 3075
88 Ga0307412_10089826 3300031911 Bacteria 2146
89 Ga0307409_100596723 3300031995 Bacteria 1091
90 Ga0307416_100077759 3300032002 Bacteria 2788
91 Ga0307414_10169231 3300032004 Bacteria 1745
92 Ga0307411_10161890 3300032005 Bacteria 1677
93 Ga0307415_100061713 3300032126 Bacteria 2597
94 Ga0373940_0011529 3300035088 Bacteria 2101
95 Ga0373953_0077543 3300035117 Bacteria 1378
96 Ga0373961_0016383 3300035241 Bacteria 1909
97 Ga0373937_0047935 3300036401 Bacteria 3909
98 Ga0436364_0654212 3300037853 Bacteria 1640
99 Ga0451807_2681847 3300041486 Bacteria 1430
100 Ga0451853_3782177 3300041512 Bacteria 3159
101 Ga0451577_0524500 3300042876 Bacteria 1076
102 Ga0451576_0017385 3300045051 Bacteria 7907
103 Ga0451576_0041502 3300045051 Bacteria 4864
104 Ga0451576_0185772 3300045051 Bacteria 2170
105 Ga0495603_0035333 3300046455 Bacteria 3002
106 Ga0495596_0039501 3300046500 Bacteria 1864
107 Ga0495643_0000407 3300046522 Bacteria 56353
108 Ga0495621_0021271 3300046539 Bacteria 2138
109 Ga0495645_0285983 3300046543 Bacteria 1083
110 Ga0495588_0008919 3300046674 Bacteria 4617
111 Ga0495623_0182791 3300046679 Bacteria 1217
112 Ga0496112_0197000 3300048915 Bacteria 1975
113 Ga0501298_039244 3300049521 Bacteria 956
114 Ga0501036_0199537 3300049572 Bacteria 1683
115 Ga0501038_0157805 3300049574 Bacteria 1846
116 Ga0501039_0110500 3300049575 Bacteria 2149
117 Ga0501039_0152280 3300049575 Bacteria 1817
118 Ga0501048_0021798 3300049582 Bacteria 4689
119 Ga0501048_0077021 3300049582 Bacteria 2354
120 Ga0501067_0084337 3300049583 Bacteria 1762
121 Ga0501068_0036955 3300049584 Bacteria 2923
122 Ga0501072_0017361 3300049588 Bacteria 5529
123 Ga0501075_0287494 3300049591 Bacteria 1253
124 Ga0501076_0227548 3300049592 Bacteria 1524
125 Ga0501077_0108012 3300049593 Bacteria 1763
126 Ga0501079_0103383 3300049741 Bacteria 2210
127 Ga0501079_0124182 3300049741 Bacteria 2008
128 Ga0501045_0036763 3300049824 Bacteria 3557
129 nmdc:mga0k408_146328_c1 3300050493 Bacteria 1407
130 nmdc:mga06r32_223666_c1 3300050510 Bacteria 1870
131 nmdc:mga08y16_208341_c1 3300050511 Bacteria 2025
132 nmdc:mga0n895_21039_c1 3300050512 Bacteria 6095
133 nmdc:mga0n895_9494_c1 3300050512 Bacteria 8515
134 nmdc:mga0a205_312449_c1 3300050515 Bacteria 1443
135 Ga0501084_0627671 3300054114 Bacteria 907
136 Ga0501082_0018561 3300060353 Bacteria 5995
137 Ga0501082_0052241 3300060353 Bacteria 3523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049521 Ga0501298_039244 Ga0501298_039244_283_942 185
2 3300050515 nmdc:mga0a205_312449_c1 nmdc:mga0a205_312449_c1_56_787 211
3 3300026089 Ga0207648_10429310 Ga0207648_104293102 214
4 3300009553 Ga0105249_10054132 Ga0105249_100541322 216
5 3300025961 Ga0207712_10032453 Ga0207712_100324532 216
6 3300026088 Ga0207641_10036960 Ga0207641_100369604 216
7 3300003322 rootL2_10043640 rootL2_100436401 218
8 3300006847 Ga0075431_100256145 Ga0075431_1002561452 221
9 3300050510 nmdc:mga06r32_223666_c1 nmdc:mga06r32_223666_c1_387_1190 221
10 3300005293 Ga0065715_10024448 Ga0065715_100244482 223
11 3300005441 Ga0070700_100185236 Ga0070700_1001852361 223
12 3300005458 Ga0070681_10168929 Ga0070681_101689292 223
13 3300005468 Ga0070707_100031171 Ga0070707_1000311716 223
14 3300006358 Ga0068871_100380612 Ga0068871_1003806122 223
15 3300009094 Ga0111539_10249676 Ga0111539_102496762 223
16 3300025885 Ga0207653_10014844 Ga0207653_100148443 223
17 3300025922 Ga0207646_10017417 Ga0207646_100174176 223
18 3300026075 Ga0207708_10124519 Ga0207708_101245192 223
19 3300035088 Ga0373940_0011529 Ga0373940_0011529_1224_2042 223
20 3300035117 Ga0373953_0077543 Ga0373953_0077543_306_1124 223
21 3300035241 Ga0373961_0016383 Ga0373961_0016383_717_1535 223
22 3300036401 Ga0373937_0047935 Ga0373937_0047935_1935_2753 223
23 3300045051 Ga0451576_0017385 Ga0451576_0017385_7042_7860 223
24 3300045051 Ga0451576_0185772 Ga0451576_0185772_626_1444 223
25 3300046455 Ga0495603_0035333 Ga0495603_0035333_612_1433 223
26 3300046539 Ga0495621_0021271 Ga0495621_0021271_1090_1908 223
27 3300046543 Ga0495645_0285983 Ga0495645_0285983_30_848 223
28 3300046674 Ga0495588_0008919 Ga0495588_0008919_1241_2062 223
29 3300046679 Ga0495623_0182791 Ga0495623_0182791_240_1058 223
30 3300050512 nmdc:mga0n895_9494_c1 nmdc:mga0n895_9494_c1_5609_6427 223
31 3300014968 Ga0157379_10076268 Ga0157379_100762683 224
32 3300046500 Ga0495596_0039501 Ga0495596_0039501_299_1075 224
33 3300060353 Ga0501082_0018561 Ga0501082_0018561_935_1768 224
34 3300028380 Ga0268265_10624135 Ga0268265_106241351 228
35 3300005355 Ga0070671_100131465 Ga0070671_1001314652 229
36 3300009094 Ga0111539_10308553 Ga0111539_103085532 229
37 3300017792 Ga0163161_10472902 Ga0163161_104729022 229
38 3300049572 Ga0501036_0199537 Ga0501036_0199537_868_1671 229
39 3300049575 Ga0501039_0152280 Ga0501039_0152280_272_1075 229
40 3300049582 Ga0501048_0077021 Ga0501048_0077021_1290_2093 229
41 3300049741 Ga0501079_0103383 Ga0501079_0103383_358_1161 229
42 3300005840 Ga0068870_10269217 Ga0068870_102692172 231
43 3300006237 Ga0097621_100400158 Ga0097621_1004001582 231
44 3300009551 Ga0105238_10631069 Ga0105238_106310692 231
45 3300014325 Ga0163163_10414413 Ga0163163_104144132 231
46 3300005340 Ga0070689_100005676 Ga0070689_1000056763 232
47 3300005547 Ga0070693_100019507 Ga0070693_1000195073 232
48 3300025936 Ga0207670_10022519 Ga0207670_100225192 232
49 3300005327 Ga0070658_10014708 Ga0070658_100147082 233
50 3300005329 Ga0070683_100247577 Ga0070683_1002475772 233
51 3300005339 Ga0070660_100069628 Ga0070660_1000696283 233
52 3300005366 Ga0070659_100076200 Ga0070659_1000762002 233
53 3300005535 Ga0070684_100098794 Ga0070684_1000987942 233
54 3300014326 Ga0157380_10011769 Ga0157380_100117692 233
55 3300025909 Ga0207705_10020682 Ga0207705_100206822 233
56 3300025919 Ga0207657_10074704 Ga0207657_100747043 233
57 3300025944 Ga0207661_10424436 Ga0207661_104244361 233
58 3300026142 Ga0207698_10418846 Ga0207698_104188462 233
59 3300046522 Ga0495643_0000407 Ga0495643_0000407_35776_36564 233
60 3300005329 Ga0070683_100721318 Ga0070683_1007213181 234
61 3300005333 Ga0070677_10201318 Ga0070677_102013181 234
62 3300005337 Ga0070682_100000418 Ga0070682_1000004187 234
63 3300005337 Ga0070682_100008951 Ga0070682_1000089514 234
64 3300005338 Ga0068868_100043053 Ga0068868_1000430533 234
65 3300005338 Ga0068868_100308927 Ga0068868_1003089272 234
66 3300005549 Ga0070704_100545182 Ga0070704_1005451821 234
67 3300005564 Ga0070664_100022529 Ga0070664_1000225292 234
68 3300005577 Ga0068857_100012451 Ga0068857_1000124517 234
69 3300005577 Ga0068857_100581594 Ga0068857_1005815942 234
70 3300006042 Ga0075368_10143544 Ga0075368_101435441 234
71 3300006195 Ga0075366_10221952 Ga0075366_102219522 234
72 3300006237 Ga0097621_100245166 Ga0097621_1002451662 234
73 3300006844 Ga0075428_100528250 Ga0075428_1005282501 234
74 3300006871 Ga0075434_100062567 Ga0075434_1000625673 234
75 3300009177 Ga0105248_10111559 Ga0105248_101115592 234
76 3300010375 Ga0105239_10008625 Ga0105239_100086258 234
77 3300013307 Ga0157372_10846330 Ga0157372_108463302 234
78 3300013308 Ga0157375_10155410 Ga0157375_101554102 234
79 3300025922 Ga0207646_10193405 Ga0207646_101934052 234
80 3300025941 Ga0207711_10027954 Ga0207711_100279544 234
81 3300025944 Ga0207661_10603654 Ga0207661_106036542 234
82 3300026041 Ga0207639_10340940 Ga0207639_103409402 234
83 3300026116 Ga0207674_10055022 Ga0207674_100550227 234
84 3300026118 Ga0207675_100772043 Ga0207675_1007720431 234
85 3300026121 Ga0207683_10359255 Ga0207683_103592553 234
86 3300031731 Ga0307405_10167623 Ga0307405_101676231 234
87 3300031852 Ga0307410_10131661 Ga0307410_101316611 234
88 3300031901 Ga0307406_10035283 Ga0307406_100352832 234
89 3300031911 Ga0307412_10089826 Ga0307412_100898262 234
90 3300031995 Ga0307409_100596723 Ga0307409_1005967232 234
91 3300032002 Ga0307416_100077759 Ga0307416_1000777591 234
92 3300032004 Ga0307414_10169231 Ga0307414_101692312 234
93 3300032005 Ga0307411_10161890 Ga0307411_101618901 234
94 3300032126 Ga0307415_100061713 Ga0307415_1000617131 234
95 3300042876 Ga0451577_0524500 Ga0451577_0524500_156_926 234
96 3300045051 Ga0451576_0041502 Ga0451576_0041502_279_1049 234
97 3300048915 Ga0496112_0197000 Ga0496112_0197000_345_1139 234
98 3300049574 Ga0501038_0157805 Ga0501038_0157805_711_1514 234
99 3300049575 Ga0501039_0110500 Ga0501039_0110500_101_904 234
100 3300049582 Ga0501048_0021798 Ga0501048_0021798_3817_4620 234
101 3300049584 Ga0501068_0036955 Ga0501068_0036955_250_1083 234
102 3300049588 Ga0501072_0017361 Ga0501072_0017361_1157_1960 234
103 3300049591 Ga0501075_0287494 Ga0501075_0287494_416_1219 234
104 3300049592 Ga0501076_0227548 Ga0501076_0227548_292_1095 234
105 3300049593 Ga0501077_0108012 Ga0501077_0108012_595_1398 234
106 3300049741 Ga0501079_0124182 Ga0501079_0124182_786_1589 234
107 3300049824 Ga0501045_0036763 Ga0501045_0036763_1534_2337 234
108 3300050493 nmdc:mga0k408_146328_c1 nmdc:mga0k408_146328_c1_521_1321 234
109 3300050512 nmdc:mga0n895_21039_c1 nmdc:mga0n895_21039_c1_4744_5514 234
110 3300054114 Ga0501084_0627671 Ga0501084_0627671_55_858 234
111 3300060353 Ga0501082_0052241 Ga0501082_0052241_1991_2794 234
112 3300009094 Ga0111539_10023491 Ga0111539_100234912 235
113 3300027907 Ga0207428_10073876 Ga0207428_100738761 235
114 3300050511 nmdc:mga08y16_208341_c1 nmdc:mga08y16_208341_c1_225_1058 235
115 3300031824 Ga0307413_10081536 Ga0307413_100815362 237
116 3300037853 Ga0436364_0654212 Ga0436364_0654212_127_948 237
117 3300005354 Ga0070675_100137919 Ga0070675_1001379193 238
118 3300005617 Ga0068859_100107991 Ga0068859_1001079912 238
119 3300006931 Ga0097620_100107991 Ga0097620_1001079912 238
120 3300025926 Ga0207659_10083791 Ga0207659_100837912 238
121 3300006847 Ga0075431_100471573 Ga0075431_1004715732 239
122 3300005618 Ga0068864_100435213 Ga0068864_1004352132 240
123 3300005467 Ga0070706_100077996 Ga0070706_1000779962 241
124 3300005549 Ga0070704_100111805 Ga0070704_1001118052 241
125 3300006844 Ga0075428_100146543 Ga0075428_1001465431 241
126 3300006847 Ga0075431_100075890 Ga0075431_1000758902 241
127 3300009147 Ga0114129_10925217 Ga0114129_109252171 241
128 3300014326 Ga0157380_10369596 Ga0157380_103695962 241
129 3300014969 Ga0157376_10513809 Ga0157376_105138091 241
130 3300025910 Ga0207684_10012959 Ga0207684_100129592 241
131 3300009551 Ga0105238_10073759 Ga0105238_100737593 242
132 3300049583 Ga0501067_0084337 Ga0501067_0084337_73_906 242
133 3300031344 Ga0265316_10000649 Ga0265316_1000064930 243
134 3300031711 Ga0265314_10000002 Ga0265314_10000002852 243
135 3300041512 Ga0451853_3782177 Ga0451853_3782177_2298_3131 243
136 3300003320 rootH2_10011980 rootH2_100119802 251
137 3300041486 Ga0451807_2681847 Ga0451807_2681847_469_1398 251

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.7669 27 251
7d6x-assembly1.cif.gz_C mycobacterium smegmatis sdh1 complex in the apo form 0.6914 27 251
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.548 77 241
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5368 77 235
6g94-assembly1.cif.gz_B structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.5033 77 235
ID Description Score Start End Superfamily
af_Q7F1F1_184_378_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.595 77 244 1.20.120.1770
af_A5JYW5_6_210_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5842 123 245 1.20.1070.10
af_Q9VIT5_59_258_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5674 33 235 1.20.120.1770
af_Q9W4H3_28_207_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5638 117 241 1.20.1070.10
af_Q9LYS9_197_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.551 77 241 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A2V5ZPF8-F1-model_v4 Succinate dehydrogenase 0.9787 125 248 GO:0016020
AF-A0A382Q0V5-F1-model_v4 Uncharacterized protein 0.9437 131 248 GO:0016020
AF-X7ZAZ0-F1-model_v4 Putative membrane protein 0.9375 128 248 GO:0016020
AF-A0A382Q0V5-F1-model_v4 Uncharacterized protein 0.9062 131 248 GO:0016020
AF-X7ZAZ0-F1-model_v4 Putative membrane protein 0.9013 128 248 GO:0016020

Feature Viewer

pLDDT pTM Quality
71.05 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map