F170657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 137 | 115 | 137 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_2681847|Ga0451807_2681847_469_1398 |
| Length | 309 |
| Sequence | MGLIAGARLQKHGPGRLGHFGAEPQEGAFHLIMTTRQLPLIGGHPNHLGGTLRSDTWWVGPLVTFTVFSGFIVYTTWAIFQSGYYYAEPYLSPLYAPVLFAKADALGGVPVDHAWFGEFPSWWPDLWFMPASPALLILPFPGLFRFTCYYYRKAYYRSFVGSPPGCAVSPGQRPKYWGETRFLLFQNLHRYALYFALIFVALLSYEAFCSFFKGGVFGVGVGSFMLTMNAVLIGAYTFGCHSFRHLIGGRDDCMSCGQNTVSYGAWKGASWFNARHMGFAWASLIWVVLTDIYVRLVSMGVITDLNTWS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 70 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 71 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 72 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 73 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 74 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 75 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 76 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 77 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 78 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 79 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 82 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 84 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 85 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 86 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 87 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 88 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 96 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 97 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 110 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.19 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 93.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10011980 | 3300003320 | Bacteria | 2676 |
| 2 | rootL2_10043640 | 3300003322 | Bacteria | 3818 |
| 3 | Ga0065715_10024448 | 3300005293 | Bacteria | 2243 |
| 4 | Ga0070658_10014708 | 3300005327 | Bacteria | 6276 |
| 5 | Ga0070683_100247577 | 3300005329 | Bacteria | 1695 |
| 6 | Ga0070683_100721318 | 3300005329 | Bacteria | 955 |
| 7 | Ga0070677_10201318 | 3300005333 | Bacteria | 961 |
| 8 | Ga0070682_100000418 | 3300005337 | Bacteria | 27599 |
| 9 | Ga0070682_100008951 | 3300005337 | Bacteria | 5655 |
| 10 | Ga0068868_100043053 | 3300005338 | Bacteria | 3527 |
| 11 | Ga0068868_100308927 | 3300005338 | Bacteria | 1345 |
| 12 | Ga0070660_100069628 | 3300005339 | Bacteria | 2744 |
| 13 | Ga0070689_100005676 | 3300005340 | Bacteria | 8552 |
| 14 | Ga0070675_100137919 | 3300005354 | Bacteria | 2083 |
| 15 | Ga0070671_100131465 | 3300005355 | Bacteria | 2108 |
| 16 | Ga0070659_100076200 | 3300005366 | Bacteria | 2675 |
| 17 | Ga0070700_100185236 | 3300005441 | Bacteria | 1452 |
| 18 | Ga0070681_10168929 | 3300005458 | Bacteria | 2109 |
| 19 | Ga0070706_100077996 | 3300005467 | Bacteria | 3067 |
| 20 | Ga0070707_100031171 | 3300005468 | Bacteria | 5078 |
| 21 | Ga0070684_100098794 | 3300005535 | Bacteria | 2604 |
| 22 | Ga0070693_100019507 | 3300005547 | Bacteria | 3556 |
| 23 | Ga0070704_100111805 | 3300005549 | Bacteria | 2080 |
| 24 | Ga0070704_100545182 | 3300005549 | Bacteria | 1013 |
| 25 | Ga0070664_100022529 | 3300005564 | Bacteria | 5195 |
| 26 | Ga0068857_100012451 | 3300005577 | Bacteria | 7406 |
| 27 | Ga0068857_100581594 | 3300005577 | Bacteria | 1057 |
| 28 | Ga0068859_100107991 | 3300005617 | Bacteria | 2844 |
| 29 | Ga0068864_100435213 | 3300005618 | Bacteria | 1252 |
| 30 | Ga0068870_10269217 | 3300005840 | Bacteria | 1063 |
| 31 | Ga0075368_10143544 | 3300006042 | Bacteria | 995 |
| 32 | Ga0075366_10221952 | 3300006195 | Bacteria | 1151 |
| 33 | Ga0097621_100245166 | 3300006237 | Bacteria | 1567 |
| 34 | Ga0097621_100400158 | 3300006237 | Bacteria | 1229 |
| 35 | Ga0068871_100380612 | 3300006358 | Bacteria | 1254 |
| 36 | Ga0075428_100146543 | 3300006844 | Bacteria | 2566 |
| 37 | Ga0075428_100528250 | 3300006844 | Bacteria | 1262 |
| 38 | Ga0075431_100075890 | 3300006847 | Bacteria | 3469 |
| 39 | Ga0075431_100256145 | 3300006847 | Bacteria | 1777 |
| 40 | Ga0075431_100471573 | 3300006847 | Bacteria | 1249 |
| 41 | Ga0075434_100062567 | 3300006871 | Bacteria | 3705 |
| 42 | Ga0097620_100107991 | 3300006931 | Bacteria | 2844 |
| 43 | Ga0111539_10023491 | 3300009094 | Bacteria | 7575 |
| 44 | Ga0111539_10249676 | 3300009094 | Bacteria | 2066 |
| 45 | Ga0111539_10308553 | 3300009094 | Bacteria | 1841 |
| 46 | Ga0114129_10925217 | 3300009147 | Bacteria | 1103 |
| 47 | Ga0105248_10111559 | 3300009177 | Bacteria | 3084 |
| 48 | Ga0105238_10073759 | 3300009551 | Bacteria | 3407 |
| 49 | Ga0105238_10631069 | 3300009551 | Bacteria | 1081 |
| 50 | Ga0105249_10054132 | 3300009553 | Bacteria | 3669 |
| 51 | Ga0105239_10008625 | 3300010375 | Bacteria | 11556 |
| 52 | Ga0157372_10846330 | 3300013307 | Bacteria | 1062 |
| 53 | Ga0157375_10155410 | 3300013308 | Bacteria | 2426 |
| 54 | Ga0163163_10414413 | 3300014325 | Bacteria | 1406 |
| 55 | Ga0157380_10011769 | 3300014326 | Bacteria | 6328 |
| 56 | Ga0157380_10369596 | 3300014326 | Bacteria | 1349 |
| 57 | Ga0157379_10076268 | 3300014968 | Bacteria | 3002 |
| 58 | Ga0157376_10513809 | 3300014969 | Bacteria | 1179 |
| 59 | Ga0163161_10472902 | 3300017792 | Bacteria | 1016 |
| 60 | Ga0207653_10014844 | 3300025885 | Bacteria | 2445 |
| 61 | Ga0207705_10020682 | 3300025909 | Bacteria | 4700 |
| 62 | Ga0207684_10012959 | 3300025910 | Bacteria | 7220 |
| 63 | Ga0207657_10074704 | 3300025919 | Bacteria | 2861 |
| 64 | Ga0207646_10017417 | 3300025922 | Bacteria | 6724 |
| 65 | Ga0207646_10193405 | 3300025922 | Bacteria | 1837 |
| 66 | Ga0207659_10083791 | 3300025926 | Bacteria | 2364 |
| 67 | Ga0207670_10022519 | 3300025936 | Bacteria | 3907 |
| 68 | Ga0207711_10027954 | 3300025941 | Bacteria | 4741 |
| 69 | Ga0207661_10424436 | 3300025944 | Bacteria | 1208 |
| 70 | Ga0207661_10603654 | 3300025944 | Bacteria | 1007 |
| 71 | Ga0207712_10032453 | 3300025961 | Bacteria | 3525 |
| 72 | Ga0207639_10340940 | 3300026041 | Bacteria | 1336 |
| 73 | Ga0207708_10124519 | 3300026075 | Bacteria | 2011 |
| 74 | Ga0207641_10036960 | 3300026088 | Bacteria | 4077 |
| 75 | Ga0207648_10429310 | 3300026089 | Bacteria | 1201 |
| 76 | Ga0207674_10055022 | 3300026116 | Bacteria | 4049 |
| 77 | Ga0207675_100772043 | 3300026118 | Bacteria | 973 |
| 78 | Ga0207683_10359255 | 3300026121 | Bacteria | 1337 |
| 79 | Ga0207698_10418846 | 3300026142 | Bacteria | 1285 |
| 80 | Ga0207428_10073876 | 3300027907 | Bacteria | 2674 |
| 81 | Ga0268265_10624135 | 3300028380 | Archaea | 1033 |
| 82 | Ga0265316_10000649 | 3300031344 | Bacteria | 38663 |
| 83 | Ga0265314_10000002 | 3300031711 | Bacteria | 2092193 |
| 84 | Ga0307405_10167623 | 3300031731 | Bacteria | 1563 |
| 85 | Ga0307413_10081536 | 3300031824 | Bacteria | 2075 |
| 86 | Ga0307410_10131661 | 3300031852 | Bacteria | 1838 |
| 87 | Ga0307406_10035283 | 3300031901 | Bacteria | 3075 |
| 88 | Ga0307412_10089826 | 3300031911 | Bacteria | 2146 |
| 89 | Ga0307409_100596723 | 3300031995 | Bacteria | 1091 |
| 90 | Ga0307416_100077759 | 3300032002 | Bacteria | 2788 |
| 91 | Ga0307414_10169231 | 3300032004 | Bacteria | 1745 |
| 92 | Ga0307411_10161890 | 3300032005 | Bacteria | 1677 |
| 93 | Ga0307415_100061713 | 3300032126 | Bacteria | 2597 |
| 94 | Ga0373940_0011529 | 3300035088 | Bacteria | 2101 |
| 95 | Ga0373953_0077543 | 3300035117 | Bacteria | 1378 |
| 96 | Ga0373961_0016383 | 3300035241 | Bacteria | 1909 |
| 97 | Ga0373937_0047935 | 3300036401 | Bacteria | 3909 |
| 98 | Ga0436364_0654212 | 3300037853 | Bacteria | 1640 |
| 99 | Ga0451807_2681847 | 3300041486 | Bacteria | 1430 |
| 100 | Ga0451853_3782177 | 3300041512 | Bacteria | 3159 |
| 101 | Ga0451577_0524500 | 3300042876 | Bacteria | 1076 |
| 102 | Ga0451576_0017385 | 3300045051 | Bacteria | 7907 |
| 103 | Ga0451576_0041502 | 3300045051 | Bacteria | 4864 |
| 104 | Ga0451576_0185772 | 3300045051 | Bacteria | 2170 |
| 105 | Ga0495603_0035333 | 3300046455 | Bacteria | 3002 |
| 106 | Ga0495596_0039501 | 3300046500 | Bacteria | 1864 |
| 107 | Ga0495643_0000407 | 3300046522 | Bacteria | 56353 |
| 108 | Ga0495621_0021271 | 3300046539 | Bacteria | 2138 |
| 109 | Ga0495645_0285983 | 3300046543 | Bacteria | 1083 |
| 110 | Ga0495588_0008919 | 3300046674 | Bacteria | 4617 |
| 111 | Ga0495623_0182791 | 3300046679 | Bacteria | 1217 |
| 112 | Ga0496112_0197000 | 3300048915 | Bacteria | 1975 |
| 113 | Ga0501298_039244 | 3300049521 | Bacteria | 956 |
| 114 | Ga0501036_0199537 | 3300049572 | Bacteria | 1683 |
| 115 | Ga0501038_0157805 | 3300049574 | Bacteria | 1846 |
| 116 | Ga0501039_0110500 | 3300049575 | Bacteria | 2149 |
| 117 | Ga0501039_0152280 | 3300049575 | Bacteria | 1817 |
| 118 | Ga0501048_0021798 | 3300049582 | Bacteria | 4689 |
| 119 | Ga0501048_0077021 | 3300049582 | Bacteria | 2354 |
| 120 | Ga0501067_0084337 | 3300049583 | Bacteria | 1762 |
| 121 | Ga0501068_0036955 | 3300049584 | Bacteria | 2923 |
| 122 | Ga0501072_0017361 | 3300049588 | Bacteria | 5529 |
| 123 | Ga0501075_0287494 | 3300049591 | Bacteria | 1253 |
| 124 | Ga0501076_0227548 | 3300049592 | Bacteria | 1524 |
| 125 | Ga0501077_0108012 | 3300049593 | Bacteria | 1763 |
| 126 | Ga0501079_0103383 | 3300049741 | Bacteria | 2210 |
| 127 | Ga0501079_0124182 | 3300049741 | Bacteria | 2008 |
| 128 | Ga0501045_0036763 | 3300049824 | Bacteria | 3557 |
| 129 | nmdc:mga0k408_146328_c1 | 3300050493 | Bacteria | 1407 |
| 130 | nmdc:mga06r32_223666_c1 | 3300050510 | Bacteria | 1870 |
| 131 | nmdc:mga08y16_208341_c1 | 3300050511 | Bacteria | 2025 |
| 132 | nmdc:mga0n895_21039_c1 | 3300050512 | Bacteria | 6095 |
| 133 | nmdc:mga0n895_9494_c1 | 3300050512 | Bacteria | 8515 |
| 134 | nmdc:mga0a205_312449_c1 | 3300050515 | Bacteria | 1443 |
| 135 | Ga0501084_0627671 | 3300054114 | Bacteria | 907 |
| 136 | Ga0501082_0018561 | 3300060353 | Bacteria | 5995 |
| 137 | Ga0501082_0052241 | 3300060353 | Bacteria | 3523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049521 | Ga0501298_039244 | Ga0501298_039244_283_942 | 185 |
| 2 | 3300050515 | nmdc:mga0a205_312449_c1 | nmdc:mga0a205_312449_c1_56_787 | 211 |
| 3 | 3300026089 | Ga0207648_10429310 | Ga0207648_104293102 | 214 |
| 4 | 3300009553 | Ga0105249_10054132 | Ga0105249_100541322 | 216 |
| 5 | 3300025961 | Ga0207712_10032453 | Ga0207712_100324532 | 216 |
| 6 | 3300026088 | Ga0207641_10036960 | Ga0207641_100369604 | 216 |
| 7 | 3300003322 | rootL2_10043640 | rootL2_100436401 | 218 |
| 8 | 3300006847 | Ga0075431_100256145 | Ga0075431_1002561452 | 221 |
| 9 | 3300050510 | nmdc:mga06r32_223666_c1 | nmdc:mga06r32_223666_c1_387_1190 | 221 |
| 10 | 3300005293 | Ga0065715_10024448 | Ga0065715_100244482 | 223 |
| 11 | 3300005441 | Ga0070700_100185236 | Ga0070700_1001852361 | 223 |
| 12 | 3300005458 | Ga0070681_10168929 | Ga0070681_101689292 | 223 |
| 13 | 3300005468 | Ga0070707_100031171 | Ga0070707_1000311716 | 223 |
| 14 | 3300006358 | Ga0068871_100380612 | Ga0068871_1003806122 | 223 |
| 15 | 3300009094 | Ga0111539_10249676 | Ga0111539_102496762 | 223 |
| 16 | 3300025885 | Ga0207653_10014844 | Ga0207653_100148443 | 223 |
| 17 | 3300025922 | Ga0207646_10017417 | Ga0207646_100174176 | 223 |
| 18 | 3300026075 | Ga0207708_10124519 | Ga0207708_101245192 | 223 |
| 19 | 3300035088 | Ga0373940_0011529 | Ga0373940_0011529_1224_2042 | 223 |
| 20 | 3300035117 | Ga0373953_0077543 | Ga0373953_0077543_306_1124 | 223 |
| 21 | 3300035241 | Ga0373961_0016383 | Ga0373961_0016383_717_1535 | 223 |
| 22 | 3300036401 | Ga0373937_0047935 | Ga0373937_0047935_1935_2753 | 223 |
| 23 | 3300045051 | Ga0451576_0017385 | Ga0451576_0017385_7042_7860 | 223 |
| 24 | 3300045051 | Ga0451576_0185772 | Ga0451576_0185772_626_1444 | 223 |
| 25 | 3300046455 | Ga0495603_0035333 | Ga0495603_0035333_612_1433 | 223 |
| 26 | 3300046539 | Ga0495621_0021271 | Ga0495621_0021271_1090_1908 | 223 |
| 27 | 3300046543 | Ga0495645_0285983 | Ga0495645_0285983_30_848 | 223 |
| 28 | 3300046674 | Ga0495588_0008919 | Ga0495588_0008919_1241_2062 | 223 |
| 29 | 3300046679 | Ga0495623_0182791 | Ga0495623_0182791_240_1058 | 223 |
| 30 | 3300050512 | nmdc:mga0n895_9494_c1 | nmdc:mga0n895_9494_c1_5609_6427 | 223 |
| 31 | 3300014968 | Ga0157379_10076268 | Ga0157379_100762683 | 224 |
| 32 | 3300046500 | Ga0495596_0039501 | Ga0495596_0039501_299_1075 | 224 |
| 33 | 3300060353 | Ga0501082_0018561 | Ga0501082_0018561_935_1768 | 224 |
| 34 | 3300028380 | Ga0268265_10624135 | Ga0268265_106241351 | 228 |
| 35 | 3300005355 | Ga0070671_100131465 | Ga0070671_1001314652 | 229 |
| 36 | 3300009094 | Ga0111539_10308553 | Ga0111539_103085532 | 229 |
| 37 | 3300017792 | Ga0163161_10472902 | Ga0163161_104729022 | 229 |
| 38 | 3300049572 | Ga0501036_0199537 | Ga0501036_0199537_868_1671 | 229 |
| 39 | 3300049575 | Ga0501039_0152280 | Ga0501039_0152280_272_1075 | 229 |
| 40 | 3300049582 | Ga0501048_0077021 | Ga0501048_0077021_1290_2093 | 229 |
| 41 | 3300049741 | Ga0501079_0103383 | Ga0501079_0103383_358_1161 | 229 |
| 42 | 3300005840 | Ga0068870_10269217 | Ga0068870_102692172 | 231 |
| 43 | 3300006237 | Ga0097621_100400158 | Ga0097621_1004001582 | 231 |
| 44 | 3300009551 | Ga0105238_10631069 | Ga0105238_106310692 | 231 |
| 45 | 3300014325 | Ga0163163_10414413 | Ga0163163_104144132 | 231 |
| 46 | 3300005340 | Ga0070689_100005676 | Ga0070689_1000056763 | 232 |
| 47 | 3300005547 | Ga0070693_100019507 | Ga0070693_1000195073 | 232 |
| 48 | 3300025936 | Ga0207670_10022519 | Ga0207670_100225192 | 232 |
| 49 | 3300005327 | Ga0070658_10014708 | Ga0070658_100147082 | 233 |
| 50 | 3300005329 | Ga0070683_100247577 | Ga0070683_1002475772 | 233 |
| 51 | 3300005339 | Ga0070660_100069628 | Ga0070660_1000696283 | 233 |
| 52 | 3300005366 | Ga0070659_100076200 | Ga0070659_1000762002 | 233 |
| 53 | 3300005535 | Ga0070684_100098794 | Ga0070684_1000987942 | 233 |
| 54 | 3300014326 | Ga0157380_10011769 | Ga0157380_100117692 | 233 |
| 55 | 3300025909 | Ga0207705_10020682 | Ga0207705_100206822 | 233 |
| 56 | 3300025919 | Ga0207657_10074704 | Ga0207657_100747043 | 233 |
| 57 | 3300025944 | Ga0207661_10424436 | Ga0207661_104244361 | 233 |
| 58 | 3300026142 | Ga0207698_10418846 | Ga0207698_104188462 | 233 |
| 59 | 3300046522 | Ga0495643_0000407 | Ga0495643_0000407_35776_36564 | 233 |
| 60 | 3300005329 | Ga0070683_100721318 | Ga0070683_1007213181 | 234 |
| 61 | 3300005333 | Ga0070677_10201318 | Ga0070677_102013181 | 234 |
| 62 | 3300005337 | Ga0070682_100000418 | Ga0070682_1000004187 | 234 |
| 63 | 3300005337 | Ga0070682_100008951 | Ga0070682_1000089514 | 234 |
| 64 | 3300005338 | Ga0068868_100043053 | Ga0068868_1000430533 | 234 |
| 65 | 3300005338 | Ga0068868_100308927 | Ga0068868_1003089272 | 234 |
| 66 | 3300005549 | Ga0070704_100545182 | Ga0070704_1005451821 | 234 |
| 67 | 3300005564 | Ga0070664_100022529 | Ga0070664_1000225292 | 234 |
| 68 | 3300005577 | Ga0068857_100012451 | Ga0068857_1000124517 | 234 |
| 69 | 3300005577 | Ga0068857_100581594 | Ga0068857_1005815942 | 234 |
| 70 | 3300006042 | Ga0075368_10143544 | Ga0075368_101435441 | 234 |
| 71 | 3300006195 | Ga0075366_10221952 | Ga0075366_102219522 | 234 |
| 72 | 3300006237 | Ga0097621_100245166 | Ga0097621_1002451662 | 234 |
| 73 | 3300006844 | Ga0075428_100528250 | Ga0075428_1005282501 | 234 |
| 74 | 3300006871 | Ga0075434_100062567 | Ga0075434_1000625673 | 234 |
| 75 | 3300009177 | Ga0105248_10111559 | Ga0105248_101115592 | 234 |
| 76 | 3300010375 | Ga0105239_10008625 | Ga0105239_100086258 | 234 |
| 77 | 3300013307 | Ga0157372_10846330 | Ga0157372_108463302 | 234 |
| 78 | 3300013308 | Ga0157375_10155410 | Ga0157375_101554102 | 234 |
| 79 | 3300025922 | Ga0207646_10193405 | Ga0207646_101934052 | 234 |
| 80 | 3300025941 | Ga0207711_10027954 | Ga0207711_100279544 | 234 |
| 81 | 3300025944 | Ga0207661_10603654 | Ga0207661_106036542 | 234 |
| 82 | 3300026041 | Ga0207639_10340940 | Ga0207639_103409402 | 234 |
| 83 | 3300026116 | Ga0207674_10055022 | Ga0207674_100550227 | 234 |
| 84 | 3300026118 | Ga0207675_100772043 | Ga0207675_1007720431 | 234 |
| 85 | 3300026121 | Ga0207683_10359255 | Ga0207683_103592553 | 234 |
| 86 | 3300031731 | Ga0307405_10167623 | Ga0307405_101676231 | 234 |
| 87 | 3300031852 | Ga0307410_10131661 | Ga0307410_101316611 | 234 |
| 88 | 3300031901 | Ga0307406_10035283 | Ga0307406_100352832 | 234 |
| 89 | 3300031911 | Ga0307412_10089826 | Ga0307412_100898262 | 234 |
| 90 | 3300031995 | Ga0307409_100596723 | Ga0307409_1005967232 | 234 |
| 91 | 3300032002 | Ga0307416_100077759 | Ga0307416_1000777591 | 234 |
| 92 | 3300032004 | Ga0307414_10169231 | Ga0307414_101692312 | 234 |
| 93 | 3300032005 | Ga0307411_10161890 | Ga0307411_101618901 | 234 |
| 94 | 3300032126 | Ga0307415_100061713 | Ga0307415_1000617131 | 234 |
| 95 | 3300042876 | Ga0451577_0524500 | Ga0451577_0524500_156_926 | 234 |
| 96 | 3300045051 | Ga0451576_0041502 | Ga0451576_0041502_279_1049 | 234 |
| 97 | 3300048915 | Ga0496112_0197000 | Ga0496112_0197000_345_1139 | 234 |
| 98 | 3300049574 | Ga0501038_0157805 | Ga0501038_0157805_711_1514 | 234 |
| 99 | 3300049575 | Ga0501039_0110500 | Ga0501039_0110500_101_904 | 234 |
| 100 | 3300049582 | Ga0501048_0021798 | Ga0501048_0021798_3817_4620 | 234 |
| 101 | 3300049584 | Ga0501068_0036955 | Ga0501068_0036955_250_1083 | 234 |
| 102 | 3300049588 | Ga0501072_0017361 | Ga0501072_0017361_1157_1960 | 234 |
| 103 | 3300049591 | Ga0501075_0287494 | Ga0501075_0287494_416_1219 | 234 |
| 104 | 3300049592 | Ga0501076_0227548 | Ga0501076_0227548_292_1095 | 234 |
| 105 | 3300049593 | Ga0501077_0108012 | Ga0501077_0108012_595_1398 | 234 |
| 106 | 3300049741 | Ga0501079_0124182 | Ga0501079_0124182_786_1589 | 234 |
| 107 | 3300049824 | Ga0501045_0036763 | Ga0501045_0036763_1534_2337 | 234 |
| 108 | 3300050493 | nmdc:mga0k408_146328_c1 | nmdc:mga0k408_146328_c1_521_1321 | 234 |
| 109 | 3300050512 | nmdc:mga0n895_21039_c1 | nmdc:mga0n895_21039_c1_4744_5514 | 234 |
| 110 | 3300054114 | Ga0501084_0627671 | Ga0501084_0627671_55_858 | 234 |
| 111 | 3300060353 | Ga0501082_0052241 | Ga0501082_0052241_1991_2794 | 234 |
| 112 | 3300009094 | Ga0111539_10023491 | Ga0111539_100234912 | 235 |
| 113 | 3300027907 | Ga0207428_10073876 | Ga0207428_100738761 | 235 |
| 114 | 3300050511 | nmdc:mga08y16_208341_c1 | nmdc:mga08y16_208341_c1_225_1058 | 235 |
| 115 | 3300031824 | Ga0307413_10081536 | Ga0307413_100815362 | 237 |
| 116 | 3300037853 | Ga0436364_0654212 | Ga0436364_0654212_127_948 | 237 |
| 117 | 3300005354 | Ga0070675_100137919 | Ga0070675_1001379193 | 238 |
| 118 | 3300005617 | Ga0068859_100107991 | Ga0068859_1001079912 | 238 |
| 119 | 3300006931 | Ga0097620_100107991 | Ga0097620_1001079912 | 238 |
| 120 | 3300025926 | Ga0207659_10083791 | Ga0207659_100837912 | 238 |
| 121 | 3300006847 | Ga0075431_100471573 | Ga0075431_1004715732 | 239 |
| 122 | 3300005618 | Ga0068864_100435213 | Ga0068864_1004352132 | 240 |
| 123 | 3300005467 | Ga0070706_100077996 | Ga0070706_1000779962 | 241 |
| 124 | 3300005549 | Ga0070704_100111805 | Ga0070704_1001118052 | 241 |
| 125 | 3300006844 | Ga0075428_100146543 | Ga0075428_1001465431 | 241 |
| 126 | 3300006847 | Ga0075431_100075890 | Ga0075431_1000758902 | 241 |
| 127 | 3300009147 | Ga0114129_10925217 | Ga0114129_109252171 | 241 |
| 128 | 3300014326 | Ga0157380_10369596 | Ga0157380_103695962 | 241 |
| 129 | 3300014969 | Ga0157376_10513809 | Ga0157376_105138091 | 241 |
| 130 | 3300025910 | Ga0207684_10012959 | Ga0207684_100129592 | 241 |
| 131 | 3300009551 | Ga0105238_10073759 | Ga0105238_100737593 | 242 |
| 132 | 3300049583 | Ga0501067_0084337 | Ga0501067_0084337_73_906 | 242 |
| 133 | 3300031344 | Ga0265316_10000649 | Ga0265316_1000064930 | 243 |
| 134 | 3300031711 | Ga0265314_10000002 | Ga0265314_10000002852 | 243 |
| 135 | 3300041512 | Ga0451853_3782177 | Ga0451853_3782177_2298_3131 | 243 |
| 136 | 3300003320 | rootH2_10011980 | rootH2_100119802 | 251 |
| 137 | 3300041486 | Ga0451807_2681847 | Ga0451807_2681847_469_1398 | 251 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d6x-assembly1.cif.gz_C | mycobacterium smegmatis sdh1 complex in the apo form | 0.7669 | 27 | 251 |
| 7d6x-assembly1.cif.gz_C | mycobacterium smegmatis sdh1 complex in the apo form | 0.6914 | 27 | 251 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.548 | 77 | 241 |
| 6g94-assembly1.cif.gz_B | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.5368 | 77 | 235 |
| 6g94-assembly1.cif.gz_B | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.5033 | 77 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7F1F1_184_378_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.595 | 77 | 244 | 1.20.120.1770 |
| af_A5JYW5_6_210_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5842 | 123 | 245 | 1.20.1070.10 |
| af_Q9VIT5_59_258_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5674 | 33 | 235 | 1.20.120.1770 |
| af_Q9W4H3_28_207_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5638 | 117 | 241 | 1.20.1070.10 |
| af_Q9LYS9_197_382_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.551 | 77 | 241 | 2.60.120.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5ZPF8-F1-model_v4 | Succinate dehydrogenase | 0.9787 | 125 | 248 |
GO:0016020
|
| AF-A0A382Q0V5-F1-model_v4 | Uncharacterized protein | 0.9437 | 131 | 248 |
GO:0016020
|
| AF-X7ZAZ0-F1-model_v4 | Putative membrane protein | 0.9375 | 128 | 248 |
GO:0016020
|
| AF-A0A382Q0V5-F1-model_v4 | Uncharacterized protein | 0.9062 | 131 | 248 |
GO:0016020
|
| AF-X7ZAZ0-F1-model_v4 | Putative membrane protein | 0.9013 | 128 | 248 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar