F170301

General Info

Members Datasets Scaffolds Average Seq Length
137 83 134 277

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10000609|Ga0265327_100006092
Length 318
Sequence MIPHVGEQIGLLNFVACLHILIVLSSIICQLNIMQLTLGFSPCPNDTFIFDALVNNKIDTEGLEFNVVLEDVQTLNRWAIEGKLDLSKISYGVLPLVLDNYITLNSGGALGKGVGPLLITADATLAGGNLQPDTLIAIPGINTTAHMLFSLAYPNAKNKVFKVFNEIEDFVLANKSPNGEPVAGVIIHENRFTYHLKGLHKIVDLGDYWERTTGLPIPLGGIVAKRTLDAELVQKVDRLISKSVEYAYANNHKVLADYVKQHSQEMSEDVMRQHIDLYVNNYSIALGDDGKHAVNKLLEVYEGLNGKANKVEDIFVAI

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
77 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
78 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
79 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
80 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
81 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
82 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
83 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.84
Nodule 0
Rhizoplane 0
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010889 3300003203 Bacteria 4008
2 rootL2_10089895 3300003322 Bacteria 6685
3 rootH1_10390798 3300003323 Unclassified 1060
4 JGI25160J50197_1001170 3300003354 Bacteria 13370
5 Ga0070683_100012072 3300005329 Bacteria 7495
6 Ga0068869_100252159 3300005334 Bacteria 1410
7 Ga0070680_100343989 3300005336 Bacteria 1268
8 Ga0070682_100011250 3300005337 Bacteria 5107
9 Ga0068868_100578545 3300005338 Bacteria 993
10 Ga0070660_100093835 3300005339 Bacteria 2370
11 Ga0070675_100034061 3300005354 Bacteria 4132
12 Ga0070673_100064345 3300005364 Bacteria 2922
13 Ga0070659_100006780 3300005366 Bacteria 8287
14 Ga0070662_100038678 3300005457 Bacteria 3389
15 Ga0068867_100332508 3300005459 Unclassified 1262
16 Ga0070707_100128886 3300005468 Bacteria 2459
17 Ga0070698_100421119 3300005471 Unclassified 1270
18 Ga0070679_100111951 3300005530 Bacteria 2716
19 Ga0070679_100209253 3300005530 Bacteria 1915
20 Ga0070684_100020996 3300005535 Bacteria 5424
21 Ga0068856_100054874 3300005614 Bacteria 3932
22 Ga0068852_100045144 3300005616 Bacteria 3747
23 Ga0068864_100158934 3300005618 Unclassified 2053
24 Ga0068864_100364194 3300005618 Bacteria 1367
25 Ga0081539_10001239 3300005985 Bacteria 45441
26 Ga0070712_100023184 3300006175 Unclassified 4097
27 Ga0075366_10105481 3300006195 Unclassified 1694
28 Ga0068871_100019894 3300006358 Bacteria 5133
29 Ga0075431_100617055 3300006847 Bacteria 1067
30 Ga0111539_10206103 3300009094 Bacteria 2292
31 Ga0105237_10007096 3300009545 Bacteria 12313
32 Ga0105239_10232751 3300010375 Bacteria 2067
33 Ga0105239_10773954 3300010375 Bacteria 1099
34 Ga0157373_10013209 3300013100 Bacteria 6062
35 Ga0157371_10097514 3300013102 Bacteria 2084
36 Ga0157370_10134070 3300013104 Bacteria 2309
37 Ga0157370_10605867 3300013104 Unclassified 1003
38 Ga0157369_10015348 3300013105 Bacteria 8637
39 Ga0157374_10131905 3300013296 Bacteria 2418
40 Ga0157378_10050811 3300013297 Bacteria 3688
41 Ga0163162_10091843 3300013306 Bacteria 3119
42 Ga0157372_10076396 3300013307 Bacteria 3782
43 Ga0157375_10259989 3300013308 Unclassified 1898
44 Ga0157380_10150929 3300014326 Bacteria 2009
45 Ga0157380_10465752 3300014326 Bacteria 1218
46 Ga0213876_10025510 3300021384 Bacteria 3117
47 Ga0207426_1000105 3300025302 Bacteria 247269
48 Ga0207671_10068996 3300025914 Bacteria 2635
49 Ga0207657_10025384 3300025919 Bacteria 5465
50 Ga0207652_10136447 3300025921 Bacteria 2191
51 Ga0207646_10013245 3300025922 Bacteria 7890
52 Ga0207659_10046995 3300025926 Bacteria 3051
53 Ga0207659_10048123 3300025926 Bacteria 3020
54 Ga0207706_10000817 3300025933 Bacteria 32335
55 Ga0207689_10065310 3300025942 Bacteria 2993
56 Ga0207679_10023622 3300025945 Bacteria 4206
57 Ga0207651_10293094 3300025960 Bacteria 1350
58 Ga0207639_10359662 3300026041 Unclassified 1302
59 Ga0207648_10096318 3300026089 Bacteria 2589
60 Ga0207676_10176461 3300026095 Bacteria 1867
61 Ga0265327_10000609 3300031251 Bacteria 59168
62 Ga0395905_0152087 3300037471 Unclassified 2177
63 Ga0436365_0017022 3300039437 Bacteria 19896
64 Ga0439435_0022831 3300042436 Bacteria 1636
65 Ga0451577_0001984 3300042876 Bacteria 25599
66 Ga0451577_0012695 3300042876 Bacteria 7904
67 Ga0451577_0033834 3300042876 Bacteria 4608
68 Ga0451577_0036464 3300042876 Bacteria 4426
69 Ga0451577_0052997 3300042876 Bacteria 3622
70 Ga0451577_0072949 3300042876 Bacteria 3063
71 Ga0451577_0078490 3300042876 Bacteria 2943
72 Ga0451577_0095705 3300042876 Bacteria 2651
73 Ga0451577_0114748 3300042876 Bacteria 2411
74 Ga0451577_0138853 3300042876 Bacteria 2183
75 Ga0451577_0226421 3300042876 Bacteria 1690
76 Ga0451577_0390403 3300042876 Bacteria 1263
77 Ga0466972_0000025 3300044658 Bacteria 186601
78 Ga0453683_0000244 3300044673 Bacteria 72720
79 Ga0453683_0000691 3300044673 Bacteria 35481
80 Ga0453683_0007138 3300044673 Bacteria 7612
81 Ga0453683_0031125 3300044673 Bacteria 3371
82 Ga0453683_0031484 3300044673 Bacteria 3351
83 Ga0453683_0044016 3300044673 Bacteria 2800
84 Ga0453683_0046941 3300044673 Bacteria 2707
85 Ga0453683_0054758 3300044673 Bacteria 2497
86 Ga0453683_0056554 3300044673 Unclassified 2455
87 Ga0453683_0146626 3300044673 Bacteria 1490
88 Ga0453684_0001140 3300044712 Bacteria 82923
89 Ga0453684_0001543 3300044712 Bacteria 64332
90 Ga0453684_0002476 3300044712 Bacteria 44625
91 Ga0453684_0003306 3300044712 Bacteria 36753
92 Ga0453684_0006785 3300044712 Bacteria 21538
93 Ga0453684_0009724 3300044712 Bacteria 16715
94 Ga0453684_0014700 3300044712 Bacteria 12478
95 Ga0453684_0017183 3300044712 Bacteria 11237
96 Ga0453684_0026736 3300044712 Bacteria 8316
97 Ga0453684_0034423 3300044712 Bacteria 7031
98 Ga0453684_0040250 3300044712 Bacteria 6352
99 Ga0453684_0069389 3300044712 Bacteria 4470
100 Ga0453684_0224181 3300044712 Bacteria 2175
101 Ga0453684_0408785 3300044712 Bacteria 1518
102 Ga0453684_0804342 3300044712 Bacteria 1013
103 Ga0466970_0003434 3300044765 Bacteria 7712
104 Ga0451576_0000581 3300045051 Bacteria 77434
105 Ga0451576_0002384 3300045051 Bacteria 28282
106 Ga0451576_0003731 3300045051 Bacteria 20600
107 Ga0451576_0016435 3300045051 Bacteria 8169
108 Ga0451576_0034464 3300045051 Bacteria 5376
109 Ga0451576_0092465 3300045051 Bacteria 3146
110 Ga0451576_0146211 3300045051 Bacteria 2464
111 Ga0451576_0154196 3300045051 Unclassified 2396
112 Ga0451576_0164290 3300045051 Bacteria 2317
113 Ga0451576_0235423 3300045051 Bacteria 1912
114 Ga0451576_0288000 3300045051 Bacteria 1717
115 Ga0451576_0430664 3300045051 Bacteria 1384
116 Ga0451576_0508570 3300045051 Bacteria 1265
117 Ga0495608_0197228 3300046511 Bacteria 1270
118 Ga0501034_0022667 3300049571 Bacteria 6396
119 Ga0501034_0410452 3300049571 Unclassified 1276
120 Ga0501036_0369843 3300049572 Bacteria 1197
121 Ga0501037_0415805 3300049573 Bacteria 921
122 Ga0501042_0223535 3300049578 Bacteria 1358
123 Ga0501080_0416185 3300049742 Bacteria 1208
124 Ga0501044_0014346 3300049823 Bacteria 8555
125 Ga0501045_0035421 3300049824 Bacteria 3624
126 nmdc:mga0k408_100174_c1 3300050493 Unclassified 1708
127 nmdc:mga0qj67_517332_c1 3300050509 Bacteria 959
128 nmdc:mga08y16_264187_c1 3300050511 Bacteria 1777
129 Ga0500644_0009631 3300053088 Bacteria 2591
130 Ga0500562_000061 3300053108 Bacteria 53142
131 Ga0500616_0183422 3300053153 Bacteria 940
132 Ga0500622_0000156 3300053156 Bacteria 71907
133 Ga0530510_0017699 3300061734 Bacteria 5050
134 Ga0530510_0128280 3300061734 Bacteria 1865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10131905 Ga0157374_101319052 236
2 3300042876 Ga0451577_0095705 Ga0451577_0095705_183_1007 239
3 3300005334 Ga0068869_100252159 Ga0068869_1002521592 257
4 3300010375 Ga0105239_10773954 Ga0105239_107739541 257
5 3300025942 Ga0207689_10065310 Ga0207689_100653104 257
6 iso_pu_bacteria 2946013367 2946014925 261
7 3300042876 Ga0451577_0033834 Ga0451577_0033834_1454_2284 262
8 3300044673 Ga0453683_0000691 Ga0453683_0000691_12217_13047 262
9 3300044712 Ga0453684_0034423 Ga0453684_0034423_1184_2014 262
10 3300045051 Ga0451576_0002384 Ga0451576_0002384_5018_5848 262
11 3300003323 rootH1_10390798 rootH1_103907982 264
12 3300042876 Ga0451577_0012695 Ga0451577_0012695_6406_7236 264
13 3300044673 Ga0453683_0007138 Ga0453683_0007138_4385_5215 264
14 3300044673 Ga0453683_0031484 Ga0453683_0031484_126_956 264
15 3300045051 Ga0451576_0146211 Ga0451576_0146211_1226_2056 264
16 3300025926 Ga0207659_10048123 Ga0207659_100481232 266
17 iso_pu_bacteria 2929154850 2929155034 266
18 3300013104 Ga0157370_10605867 Ga0157370_106058671 267
19 3300005336 Ga0070680_100343989 Ga0070680_1003439891 268
20 3300005459 Ga0068867_100332508 Ga0068867_1003325082 271
21 3300044673 Ga0453683_0054758 Ga0453683_0054758_115_954 271
22 3300005530 Ga0070679_100209253 Ga0070679_1002092532 272
23 3300021384 Ga0213876_10025510 Ga0213876_100255103 272
24 3300025921 Ga0207652_10136447 Ga0207652_101364472 272
25 3300039437 Ga0436365_0017022 Ga0436365_0017022_15567_16385 272
26 3300053088 Ga0500644_0009631 Ga0500644_0009631_395_1249 273
27 3300053108 Ga0500562_000061 Ga0500562_000061_16969_17823 273
28 iso_pu_bacteria 2818991444 2819590267 273
29 3300049572 Ga0501036_0369843 Ga0501036_0369843_325_1149 274
30 3300049578 Ga0501042_0223535 Ga0501042_0223535_73_897 274
31 3300049824 Ga0501045_0035421 Ga0501045_0035421_22_846 274
32 3300005618 Ga0068864_100158934 Ga0068864_1001589342 275
33 3300009094 Ga0111539_10206103 Ga0111539_102061032 275
34 3300013308 Ga0157375_10259989 Ga0157375_102599892 275
35 3300014326 Ga0157380_10150929 Ga0157380_101509292 275
36 3300026095 Ga0207676_10176461 Ga0207676_101764611 275
37 3300042876 Ga0451577_0036464 Ga0451577_0036464_1707_2543 275
38 3300044658 Ga0466972_0000025 Ga0466972_0000025_92405_93235 275
39 3300044712 Ga0453684_0040250 Ga0453684_0040250_1393_2229 275
40 3300044712 Ga0453684_0224181 Ga0453684_0224181_85_918 275
41 3300044765 Ga0466970_0003434 Ga0466970_0003434_2268_3098 275
42 3300045051 Ga0451576_0000581 Ga0451576_0000581_64125_64958 275
43 3300045051 Ga0451576_0430664 Ga0451576_0430664_369_1205 275
44 3300050511 nmdc:mga08y16_264187_c1 nmdc:mga08y16_264187_c1_202_1035 275
45 3300006847 Ga0075431_100617055 Ga0075431_1006170551 276
46 3300042876 Ga0451577_0001984 Ga0451577_0001984_20246_21085 276
47 3300042876 Ga0451577_0138853 Ga0451577_0138853_854_1687 276
48 3300042876 Ga0451577_0226421 Ga0451577_0226421_576_1406 276
49 3300042876 Ga0451577_0390403 Ga0451577_0390403_64_930 276
50 3300044673 Ga0453683_0000244 Ga0453683_0000244_64420_65259 276
51 3300044673 Ga0453683_0031125 Ga0453683_0031125_550_1413 276
52 3300044673 Ga0453683_0044016 Ga0453683_0044016_1707_2537 276
53 3300044673 Ga0453683_0046941 Ga0453683_0046941_12_875 276
54 3300044673 Ga0453683_0056554 Ga0453683_0056554_47_910 276
55 3300044712 Ga0453684_0001140 Ga0453684_0001140_33431_34270 276
56 3300044712 Ga0453684_0003306 Ga0453684_0003306_23250_24083 276
57 3300044712 Ga0453684_0006785 Ga0453684_0006785_16142_16975 276
58 3300044712 Ga0453684_0009724 Ga0453684_0009724_13658_14491 276
59 3300044712 Ga0453684_0408785 Ga0453684_0408785_525_1358 276
60 3300044712 Ga0453684_0804342 Ga0453684_0804342_56_889 276
61 3300045051 Ga0451576_0003731 Ga0451576_0003731_8085_8915 276
62 3300045051 Ga0451576_0154196 Ga0451576_0154196_525_1388 276
63 3300045051 Ga0451576_0164290 Ga0451576_0164290_1353_2192 276
64 3300045051 Ga0451576_0288000 Ga0451576_0288000_624_1457 276
65 3300046511 Ga0495608_0197228 Ga0495608_0197228_186_1022 276
66 3300050509 nmdc:mga0qj67_517332_c1 nmdc:mga0qj67_517332_c1_61_891 276
67 3300061734 Ga0530510_0128280 Ga0530510_0128280_291_1121 276
68 3300014326 Ga0157380_10465752 Ga0157380_104657522 277
69 3300026041 Ga0207639_10359662 Ga0207639_103596622 277
70 3300026089 Ga0207648_10096318 Ga0207648_100963181 277
71 3300042876 Ga0451577_0052997 Ga0451577_0052997_313_1146 277
72 3300042876 Ga0451577_0078490 Ga0451577_0078490_1806_2639 277
73 3300042876 Ga0451577_0114748 Ga0451577_0114748_506_1339 277
74 3300044673 Ga0453683_0146626 Ga0453683_0146626_627_1460 277
75 3300044712 Ga0453684_0001543 Ga0453684_0001543_1632_2465 277
76 3300044712 Ga0453684_0002476 Ga0453684_0002476_15795_16628 277
77 3300044712 Ga0453684_0014700 Ga0453684_0014700_4281_5114 277
78 3300044712 Ga0453684_0017183 Ga0453684_0017183_5990_6823 277
79 3300044712 Ga0453684_0026736 Ga0453684_0026736_6841_7674 277
80 3300044712 Ga0453684_0069389 Ga0453684_0069389_2781_3614 277
81 3300045051 Ga0451576_0034464 Ga0451576_0034464_3361_4194 277
82 3300045051 Ga0451576_0092465 Ga0451576_0092465_2081_2914 277
83 3300045051 Ga0451576_0235423 Ga0451576_0235423_601_1434 277
84 3300053153 Ga0500616_0183422 Ga0500616_0183422_20_853 277
85 3300053156 Ga0500622_0000156 Ga0500622_0000156_49627_50502 277
86 3300003354 JGI25160J50197_1001170 JGI25160J50197_10011708 278
87 3300005329 Ga0070683_100012072 Ga0070683_1000120723 278
88 3300005337 Ga0070682_100011250 Ga0070682_1000112503 278
89 3300005338 Ga0068868_100578545 Ga0068868_1005785451 278
90 3300005339 Ga0070660_100093835 Ga0070660_1000938351 278
91 3300005354 Ga0070675_100034061 Ga0070675_1000340613 278
92 3300005364 Ga0070673_100064345 Ga0070673_1000643453 278
93 3300005366 Ga0070659_100006780 Ga0070659_1000067804 278
94 3300005457 Ga0070662_100038678 Ga0070662_1000386782 278
95 3300005530 Ga0070679_100111951 Ga0070679_1001119513 278
96 3300005535 Ga0070684_100020996 Ga0070684_1000209962 278
97 3300005614 Ga0068856_100054874 Ga0068856_1000548743 278
98 3300005616 Ga0068852_100045144 Ga0068852_1000451443 278
99 3300005618 Ga0068864_100364194 Ga0068864_1003641942 278
100 3300006358 Ga0068871_100019894 Ga0068871_1000198943 278
101 3300013100 Ga0157373_10013209 Ga0157373_100132093 278
102 3300013102 Ga0157371_10097514 Ga0157371_100975142 278
103 3300013104 Ga0157370_10134070 Ga0157370_101340703 278
104 3300013105 Ga0157369_10015348 Ga0157369_100153483 278
105 3300013297 Ga0157378_10050811 Ga0157378_100508113 278
106 3300013306 Ga0163162_10091843 Ga0163162_100918433 278
107 3300025302 Ga0207426_1000105 Ga0207426_1000105144 278
108 3300025919 Ga0207657_10025384 Ga0207657_100253843 278
109 3300025926 Ga0207659_10046995 Ga0207659_100469953 278
110 3300025933 Ga0207706_10000817 Ga0207706_1000081713 278
111 3300025945 Ga0207679_10023622 Ga0207679_100236223 278
112 3300061734 Ga0530510_0017699 Ga0530510_0017699_3026_3862 278
113 3300013307 Ga0157372_10076396 Ga0157372_100763962 279
114 3300042436 Ga0439435_0022831 Ga0439435_0022831_526_1371 279
115 3300042876 Ga0451577_0072949 Ga0451577_0072949_1667_2506 279
116 3300006195 Ga0075366_10105481 Ga0075366_101054812 280
117 3300009545 Ga0105237_10007096 Ga0105237_100070964 280
118 3300010375 Ga0105239_10232751 Ga0105239_102327512 280
119 3300025914 Ga0207671_10068996 Ga0207671_100689964 280
120 3300031251 Ga0265327_10000609 Ga0265327_100006092 280
121 3300050493 nmdc:mga0k408_100174_c1 nmdc:mga0k408_100174_c1_223_1089 280
122 3300003322 rootL2_10089895 rootL2_100898952 281
123 3300005468 Ga0070707_100128886 Ga0070707_1001288863 281
124 3300005471 Ga0070698_100421119 Ga0070698_1004211192 281
125 3300006175 Ga0070712_100023184 Ga0070712_1000231844 281
126 3300025922 Ga0207646_10013245 Ga0207646_1001324510 281
127 3300025960 Ga0207651_10293094 Ga0207651_102930942 281
128 3300037471 Ga0395905_0152087 Ga0395905_0152087_273_1118 281
129 3300045051 Ga0451576_0016435 Ga0451576_0016435_6757_7611 281
130 3300045051 Ga0451576_0508570 Ga0451576_0508570_270_1115 281
131 3300049571 Ga0501034_0022667 Ga0501034_0022667_2753_3613 283
132 3300049571 Ga0501034_0410452 Ga0501034_0410452_310_1176 283
133 3300049573 Ga0501037_0415805 Ga0501037_0415805_18_878 283
134 3300049742 Ga0501080_0416185 Ga0501080_0416185_314_1180 283
135 3300049823 Ga0501044_0014346 Ga0501044_0014346_3069_3935 283
136 3300003203 JGI25406J46586_10010889 JGI25406J46586_100108893 285
137 3300005985 Ga0081539_10001239 Ga0081539_1000123951 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

36

303

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9677 3 265
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9581 2 265
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9265 2 265
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9152 3 265
3ix1-assembly1.cif.gz_A periplasmic n-formyl-4-amino-5-aminomethyl-2-methylpyrimidine binding protein from bacillus halodurans 0.7915 2 278
ID Description Score Start End Superfamily
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9385 3 273 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9255 79 175 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9065 79 175 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8977 3 273 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8801 2 265 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A257HZP2-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.994 1 266 GO:0009234
GO:0016830
AF-A0A351Q0Z1-F1-model_v4 deleted 0.9896 1 279
AF-A0A4R7CPN9-F1-model_v4 deleted 0.9876 1 266
AF-A0A6N8J2Y4-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9872 1 261 GO:0009234
GO:0016830
AF-A0A2M9CTC7-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9871 1 266 GO:0009234
GO:0016830

Feature Viewer

pLDDT pTM Quality
93.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map