F168260

General Info

Members Datasets Scaffolds Average Seq Length
136 113 112 343

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939660829|2939664204
Length 367
Sequence QTLVNQGTFPSPSFSARGPLSARLLALLRSAPDGDPGLLPLADEAIGRAAGLVHDDDIQLTLFVLYGLHYGSVVETDDAWEWHPSLIALRRHLEAAFEAELRRVVPMPELPEPTSTAVASALFALTSEDSGPGLSRFVASKANREQLAEFLVHRSIYTLKEADPHSWAIPRLTGRAKAALVEIQADEYGGGRPERMHAVIFAGTMRGLGLDDRYGIYVDHVPAVTLASLNMMSMFGLNRRLRGAIAGHLAAFEMTSSIPNGLYARGFRRNGFGEDVTWYFDEHVEADAVHEQIAGRDLAGSLAEDEPALLADILFGAAACLTVDGWASAHLLDAWTAGRSALRVPLAGEPGASGAPSAAGDAAASGA

Samples

Sample ID Description Type Environment
1 2643221616 Leifsonia sp. Root227 Isolate Unclassified
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
4 2739367653 Kocuria sp. OV113 Isolate Unclassified
5 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
6 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
7 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
8 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
9 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
10 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
11 2857727296 Kocuria sp. R-72562 Isolate Unclassified
12 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
13 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
14 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
15 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
16 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
17 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
18 2928153084 Leifsonia sp. 563 Isolate Unclassified
19 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
20 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
21 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
22 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
23 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
24 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
47 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
63 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.35
Metatranscriptomes 0
Isolates 17.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 8.82
Rhizosphere 63.24
Stem 0
Stem Tuber 0.74
Unclassified 15.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006032 3300000549 Bacteria 1519
2 JGI24740J21852_10043304 3300001979 Bacteria 1343
3 JGI24735J21928_10001550 3300002067 Bacteria 8136
4 JGI25154J39366_1003012 3300002738 Bacteria 3831
5 JGI25164J39214_1000373 3300002772 Bacteria 26703
6 JGI25165J46597_1000014 3300003214 Bacteria 390383
7 Ga0055539_1000014 3300003752 Bacteria 381086
8 Ga0055533_1000002 3300003756 Bacteria 1196393
9 Ga0055525_1000115 3300003759 Bacteria 121883
10 Ga0055541_1000859 3300003841 Bacteria 7409
11 Ga0065714_10004646 3300005288 Bacteria 4638
12 Ga0070676_10084423 3300005328 Bacteria 1933
13 Ga0070672_100134219 3300005543 Bacteria 2037
14 Ga0075364_10063662 3300006051 Bacteria 2421
15 Ga0157369_10038125 3300013105 Bacteria 5257
16 Ga0163162_10255946 3300013306 Bacteria 1883
17 Ga0157375_10271085 3300013308 Bacteria 1859
18 Ga0209566_100056 3300025225 Bacteria 209595
19 Ga0209674_100001 3300025226 Bacteria 4013750
20 Ga0209563_100001 3300025230 Bacteria 4013775
21 Ga0209563_100172 3300025230 Bacteria 45261
22 Ga0207427_100041 3300025231 Bacteria 263659
23 Ga0209437_100980 3300025233 Bacteria 10072
24 Ga0209646_1000013 3300025246 Bacteria 565830
25 Ga0209646_1000014 3300025246 Bacteria 550484
26 Ga0209677_100001 3300025253 Bacteria 4013787
27 Ga0209233_1000014 3300025261 Bacteria 996641
28 Ga0207647_10081023 3300025904 Bacteria 1945
29 Ga0207691_10176242 3300025940 Bacteria 1870
30 Ga0265327_10000062 3300031251 Bacteria 234320
31 Ga0307408_100014620 3300031548 Bacteria 5215
32 Ga0307408_100032391 3300031548 Bacteria 3644
33 Ga0307408_100216418 3300031548 Bacteria 1560
34 Ga0307405_10019699 3300031731 Bacteria 3754
35 Ga0307413_10121043 3300031824 Bacteria 1773
36 Ga0307410_10003122 3300031852 Bacteria 8226
37 Ga0307410_10072502 3300031852 Bacteria 2391
38 Ga0307410_10123495 3300031852 Bacteria 1892
39 Ga0307410_10327097 3300031852 Bacteria 1218
40 Ga0307406_10021879 3300031901 Bacteria 3788
41 Ga0307406_10055026 3300031901 Bacteria 2542
42 Ga0307406_10141394 3300031901 Bacteria 1704
43 Ga0307412_10013108 3300031911 Bacteria 4850
44 Ga0307412_10149138 3300031911 Bacteria 1723
45 Ga0307414_10186535 3300032004 Bacteria 1674
46 Ga0307411_10089760 3300032005 Bacteria 2142
47 Ga0307411_10136903 3300032005 Bacteria 1800
48 Ga0395899_0000864 3300037312 Bacteria 28841
49 Ga0395900_0329296 3300037418 Bacteria 1506
50 Ga0451793_0187380 3300041452 Bacteria 1830
51 Ga0439433_0007223 3300041999 Bacteria 2399
52 Ga0439449_0053182 3300042007 Bacteria 1497
53 Ga0450920_007315 3300042122 Bacteria 2000
54 Ga0466972_0009972 3300044658 Bacteria 4769
55 Ga0466965_0000006 3300044683 Bacteria 158069
56 Ga0466966_0064459 3300044684 Bacteria 2306
57 Ga0466961_0043615 3300044693 Bacteria 2872
58 Ga0466970_0004156 3300044765 Bacteria 7124
59 Ga0466970_0083497 3300044765 Bacteria 1728
60 Ga0466970_0181314 3300044765 Bacteria 1168
61 Ga0466957_0002857 3300044842 Bacteria 9349
62 Ga0466960_0119642 3300044901 Bacteria 1378
63 Ga0466959_0012502 3300045049 Bacteria 6136
64 Ga0466959_0042503 3300045049 Bacteria 3352
65 Ga0466958_0019000 3300045836 Bacteria 3996
66 Ga0495653_0012980 3300046463 Bacteria 6797
67 Ga0495662_0007832 3300046476 Bacteria 5259
68 Ga0495630_0079103 3300046517 Bacteria 2480
69 Ga0495665_0001325 3300046531 Bacteria 13203
70 Ga0495587_0007020 3300046536 Bacteria 7313
71 Ga0495588_0036332 3300046674 Bacteria 2499
72 Ga0495657_0077540 3300046675 Bacteria 2156
73 Ga0495623_0034144 3300046679 Bacteria 3263
74 Ga0495600_0060580 3300046809 Bacteria 2471
75 Ga0495581_0009589 3300047315 Bacteria 5599
76 Ga0495680_0121296 3300047322 Bacteria 1930
77 Ga0496100_0213950 3300048903 Bacteria 1411
78 Ga0496102_0086715 3300048905 Bacteria 2891
79 Ga0496103_0080777 3300048906 Bacteria 2044
80 Ga0496103_0121719 3300048906 Bacteria 1662
81 Ga0496104_0185271 3300048907 Bacteria 1992
82 Ga0496104_0305538 3300048907 Bacteria 1503
83 Ga0496107_0108729 3300048910 Bacteria 2036
84 Ga0496109_0353779 3300048912 Bacteria 1387
85 Ga0496111_0136857 3300048914 Bacteria 1814
86 Ga0496111_0166620 3300048914 Bacteria 1636
87 Ga0496113_0125037 3300048916 Bacteria 2013
88 Ga0496117_0016389 3300048920 Bacteria 6257
89 Ga0496118_0003736 3300048921 Bacteria 18837
90 Ga0496122_0008168 3300048925 Bacteria 11383
91 Ga0496125_0038555 3300048928 Bacteria 4132
92 Ga0496125_0115540 3300048928 Bacteria 1930
93 Ga0501031_0062525 3300049568 Bacteria 2426
94 Ga0501032_0007329 3300049569 Bacteria 8064
95 Ga0501033_0168209 3300049570 Bacteria 1575
96 Ga0501034_0050269 3300049571 Bacteria 4205
97 Ga0501034_0116988 3300049571 Bacteria 2653
98 Ga0501034_0169608 3300049571 Bacteria 2150
99 Ga0501034_0189126 3300049571 Bacteria 2021
100 Ga0501036_0177258 3300049572 Bacteria 1795
101 Ga0501037_0026001 3300049573 Bacteria 4324
102 Ga0501038_0088024 3300049574 Bacteria 2607
103 Ga0501042_0000895 3300049578 Bacteria 16665
104 Ga0501047_0230550 3300049581 Bacteria 1705
105 Ga0501047_0351760 3300049581 Bacteria 1310
106 Ga0501048_0029165 3300049582 Bacteria 4003
107 Ga0501067_0051865 3300049583 Bacteria 2273
108 Ga0501083_0014311 3300049744 Bacteria 5548
109 Ga0501044_0155462 3300049823 Bacteria 2267
110 Ga0501044_0218601 3300049823 Bacteria 1856
111 Ga0500559_0001010 3300053136 Bacteria 17331
112 Ga0501082_0022411 3300060353 Bacteria 5440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0187380 Ga0451793_0187380_243_1226 290
2 3300003752 Ga0055539_1000014 Ga0055539_1000014209 295
3 3300003756 Ga0055533_1000002 Ga0055533_1000002996 295
4 3300003759 Ga0055525_1000115 Ga0055525_100011598 295
5 3300003841 Ga0055541_1000859 Ga0055541_10008597 295
6 3300025225 Ga0209566_100056 Ga0209566_10005617 295
7 3300025226 Ga0209674_100001 Ga0209674_1000012571 295
8 3300025230 Ga0209563_100001 Ga0209563_1000012571 295
9 3300025253 Ga0209677_100001 Ga0209677_1000012571 295
10 3300049583 Ga0501067_0051865 Ga0501067_0051865_1277_2251 300
11 iso_pu_bacteria 2643221616 2644097694 301
12 3300048910 Ga0496107_0108729 Ga0496107_0108729_61_1035 303
13 3300049568 Ga0501031_0062525 Ga0501031_0062525_1464_2414 305
14 3300049823 Ga0501044_0218601 Ga0501044_0218601_18_974 305
15 3300045049 Ga0466959_0042503 Ga0466959_0042503_2113_3129 307
16 3300045836 Ga0466958_0019000 Ga0466958_0019000_1072_2088 307
17 3300048928 Ga0496125_0115540 Ga0496125_0115540_724_1695 312
18 3300049569 Ga0501032_0007329 Ga0501032_0007329_1992_3014 314
19 3300049571 Ga0501034_0169608 Ga0501034_0169608_273_1295 314
20 3300049581 Ga0501047_0230550 Ga0501047_0230550_294_1316 314
21 3300049582 Ga0501048_0029165 Ga0501048_0029165_1658_2680 314
22 3300049744 Ga0501083_0014311 Ga0501083_0014311_3206_4228 314
23 3300060353 Ga0501082_0022411 Ga0501082_0022411_1455_2477 314
24 3300006051 Ga0075364_10063662 Ga0075364_100636624 316
25 3300053136 Ga0500559_0001010 Ga0500559_0001010_319_1320 317
26 3300025230 Ga0209563_100172 Ga0209563_10017239 318
27 3300048925 Ga0496122_0008168 Ga0496122_0008168_7772_8812 323
28 3300048928 Ga0496125_0038555 Ga0496125_0038555_929_1969 323
29 iso_pu_bacteria 2643221690 2644504120 323
30 iso_pu_bacteria 2747842429 2747954539 323
31 iso_pu_bacteria 2857723135 2857726567 323
32 3300031901 Ga0307406_10021879 Ga0307406_100218793 324
33 3300032004 Ga0307414_10186535 Ga0307414_101865352 324
34 3300049578 Ga0501042_0000895 Ga0501042_0000895_476_1483 324
35 iso_pu_bacteria 2946080515 2946083885 324
36 iso_pu_bacteria 8004182704 8004184402 324
37 3300002738 JGI25154J39366_1003012 JGI25154J39366_10030123 325
38 3300025246 Ga0209646_1000013 Ga0209646_1000013415 325
39 3300025246 Ga0209646_1000014 Ga0209646_1000014208 325
40 3300031852 Ga0307410_10123495 Ga0307410_101234952 325
41 3300031901 Ga0307406_10141394 Ga0307406_101413941 325
42 3300044693 Ga0466961_0043615 Ga0466961_0043615_1649_2686 325
43 3300049571 Ga0501034_0050269 Ga0501034_0050269_1565_2611 325
44 iso_pu_bacteria 2808606306 2808629824 325
45 3300049571 Ga0501034_0116988 Ga0501034_0116988_453_1505 326
46 3300049571 Ga0501034_0189126 Ga0501034_0189126_624_1676 326
47 3300049572 Ga0501036_0177258 Ga0501036_0177258_52_1104 326
48 3300049574 Ga0501038_0088024 Ga0501038_0088024_887_1933 326
49 3300049823 Ga0501044_0155462 Ga0501044_0155462_1003_2055 326
50 3300031251 Ga0265327_10000062 Ga0265327_10000062243 327
51 iso_pu_bacteria 2945956166 2945960461 328
52 iso_pu_bacteria 2953998280 2953998387 328
53 3300031548 Ga0307408_100032391 Ga0307408_1000323913 329
54 3300044683 Ga0466965_0000006 Ga0466965_0000006_120376_121437 329
55 iso_pu_bacteria 2690315906 2691515737 329
56 iso_pu_bacteria 2808606370 2808893117 329
57 iso_pu_bacteria 2862993130 2862995619 329
58 iso_pu_bacteria 2884994152 2884995627 329
59 iso_pu_bacteria 2919391150 2919393586 329
60 iso_pu_bacteria 2939598168 2939602047 329
61 iso_pu_bacteria 2939660829 2939664204 329
62 iso_pu_bacteria 2844841374 2844844141 330
63 iso_pu_bacteria 2884763398 2884763864 330
64 iso_pu_bacteria 2919055335 2919056078 330
65 iso_pu_bacteria 2919523602 2919526093 330
66 iso_pu_bacteria 2928153084 2928154219 330
67 3300001979 JGI24740J21852_10043304 JGI24740J21852_100433041 331
68 3300002067 JGI24735J21928_10001550 JGI24735J21928_100015501 331
69 3300002772 JGI25164J39214_1000373 JGI25164J39214_100037310 331
70 3300003214 JGI25165J46597_1000014 JGI25165J46597_1000014269 331
71 3300013105 Ga0157369_10038125 Ga0157369_100381256 331
72 3300025231 Ga0207427_100041 Ga0207427_10004158 331
73 3300025233 Ga0209437_100980 Ga0209437_1009803 331
74 3300025261 Ga0209233_1000014 Ga0209233_1000014677 331
75 3300025904 Ga0207647_10081023 Ga0207647_100810234 331
76 3300031852 Ga0307410_10327097 Ga0307410_103270971 331
77 3300037312 Ga0395899_0000864 Ga0395899_0000864_9715_10752 331
78 3300037418 Ga0395900_0329296 Ga0395900_0329296_216_1253 331
79 3300044658 Ga0466972_0009972 Ga0466972_0009972_2994_4031 331
80 3300044684 Ga0466966_0064459 Ga0466966_0064459_1105_2142 331
81 3300044765 Ga0466970_0004156 Ga0466970_0004156_1823_2860 331
82 3300044765 Ga0466970_0083497 Ga0466970_0083497_117_1154 331
83 3300044842 Ga0466957_0002857 Ga0466957_0002857_6699_7736 331
84 3300045049 Ga0466959_0012502 Ga0466959_0012502_3094_4131 331
85 3300048920 Ga0496117_0016389 Ga0496117_0016389_3103_4140 331
86 3300048921 Ga0496118_0003736 Ga0496118_0003736_9728_10765 331
87 3300049570 Ga0501033_0168209 Ga0501033_0168209_169_1212 331
88 3300049581 Ga0501047_0351760 Ga0501047_0351760_243_1286 331
89 3300044901 Ga0466960_0119642 Ga0466960_0119642_196_1254 332
90 3300000549 LJQas_1006032 LJQas_10060322 333
91 3300005288 Ga0065714_10004646 Ga0065714_100046464 333
92 3300005328 Ga0070676_10084423 Ga0070676_100844232 333
93 3300005543 Ga0070672_100134219 Ga0070672_1001342191 333
94 3300013306 Ga0163162_10255946 Ga0163162_102559461 333
95 3300013308 Ga0157375_10271085 Ga0157375_102710852 333
96 3300025940 Ga0207691_10176242 Ga0207691_101762422 333
97 3300031548 Ga0307408_100014620 Ga0307408_1000146208 333
98 3300031548 Ga0307408_100216418 Ga0307408_1002164181 333
99 3300031731 Ga0307405_10019699 Ga0307405_100196993 333
100 3300031824 Ga0307413_10121043 Ga0307413_101210432 333
101 3300031852 Ga0307410_10003122 Ga0307410_100031227 333
102 3300031852 Ga0307410_10072502 Ga0307410_100725021 333
103 3300031901 Ga0307406_10055026 Ga0307406_100550262 333
104 3300031911 Ga0307412_10013108 Ga0307412_100131085 333
105 3300031911 Ga0307412_10149138 Ga0307412_101491382 333
106 3300032005 Ga0307411_10089760 Ga0307411_100897602 333
107 3300032005 Ga0307411_10136903 Ga0307411_101369032 333
108 3300041999 Ga0439433_0007223 Ga0439433_0007223_596_1651 333
109 3300042007 Ga0439449_0053182 Ga0439449_0053182_211_1266 333
110 3300042122 Ga0450920_007315 Ga0450920_007315_396_1451 333
111 3300044765 Ga0466970_0181314 Ga0466970_0181314_73_1131 333
112 3300046463 Ga0495653_0012980 Ga0495653_0012980_4178_5233 333
113 3300046476 Ga0495662_0007832 Ga0495662_0007832_3264_4319 333
114 3300046517 Ga0495630_0079103 Ga0495630_0079103_270_1325 333
115 3300046531 Ga0495665_0001325 Ga0495665_0001325_928_1983 333
116 3300046536 Ga0495587_0007020 Ga0495587_0007020_1002_2057 333
117 3300046674 Ga0495588_0036332 Ga0495588_0036332_679_1746 333
118 3300046675 Ga0495657_0077540 Ga0495657_0077540_946_2001 333
119 3300046679 Ga0495623_0034144 Ga0495623_0034144_66_1121 333
120 3300046809 Ga0495600_0060580 Ga0495600_0060580_1336_2391 333
121 3300047315 Ga0495581_0009589 Ga0495581_0009589_1374_2429 333
122 3300047322 Ga0495680_0121296 Ga0495680_0121296_853_1908 333
123 3300048903 Ga0496100_0213950 Ga0496100_0213950_223_1278 333
124 3300048905 Ga0496102_0086715 Ga0496102_0086715_1753_2820 333
125 3300048906 Ga0496103_0080777 Ga0496103_0080777_173_1240 333
126 3300048906 Ga0496103_0121719 Ga0496103_0121719_238_1293 333
127 3300048907 Ga0496104_0185271 Ga0496104_0185271_182_1246 333
128 3300048907 Ga0496104_0305538 Ga0496104_0305538_184_1239 333
129 3300048912 Ga0496109_0353779 Ga0496109_0353779_211_1266 333
130 3300048914 Ga0496111_0136857 Ga0496111_0136857_215_1270 333
131 3300048914 Ga0496111_0166620 Ga0496111_0166620_26_1093 333
132 3300048916 Ga0496113_0125037 Ga0496113_0125037_765_1832 333
133 3300049573 Ga0501037_0026001 Ga0501037_0026001_2033_3088 333
134 iso_pu_bacteria 2739367653 2739603693 333
135 iso_pu_bacteria 2816332305 2817510190 333
136 iso_pu_bacteria 2857727296 2857728150 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

148

325

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8086 101 314
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.7949 101 314
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.77 50 316
6m9s-assembly2.cif.gz_C crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7611 50 316
6m9r-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a bound n(delta)-hydroxy-n(omega)-methyl-l-arginine intermediate 0.7611 50 316
ID Description Score Start End Superfamily
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8271 96 319 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8166 96 319 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7865 101 314 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7728 101 314 1.20.910.10
af_Q54PI1_1_203_1.20.910.10 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7305 122 306 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A1B1K6T9-F1-model_v4 Iron-containing redox enzyme family protein 0.992 148 328
AF-A0A7J9XX92-F1-model_v4 Iron-containing redox enzyme family protein 0.9912 120 299
AF-A0A6G2UQ11-F1-model_v4 Iron-containing redox enzyme family protein 0.9828 125 330
AF-A0A2S8MFG0-F1-model_v4 deleted 0.9826 138 330
AF-A0A7W0RHM3-F1-model_v4 Iron-containing redox enzyme family protein 0.9773 173 331

Feature Viewer

pLDDT pTM Quality
90.31 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map