F168211

General Info

Members Datasets Scaffolds Average Seq Length
136 100 121 210

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991437|2819545733
Length 241
Sequence RDAFCSLSRKTKANIIFERFILILDSCYLQLDTMDNNYDKIANHYDTLSRLVFFKSQVNAQVNQLQHIPKDSSVLIVGGGTGWILEEIAKIYSSGLKIVYVEISAKMITLSQKRNCKSNQVEFVNLGIEDFRSDTAFDVILTPFLFDNFVAQRAAKVFEQLNSYLRKDGLWFLADFSLNKNNGNWWKCLLLKSMYSFFKLLGIVEANHLIDMNPYFLNAGYKVLELRLYYGNFIKAVIFKK

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2739367663 Pedobacter sp. YR510 Isolate Unclassified
5 2818991437 Pedobacter terrae 518 Isolate Unclassified
6 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
7 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
8 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
15 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
100 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.97
Metatranscriptomes 0
Isolates 11.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 0
Rhizoplane 0
Rhizosphere 75.74
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1005483 3300002741 Bacteria 2062
2 JGI25152J39213_1000721 3300002773 Bacteria 17038
3 JGI25150J39212_1000003 3300002774 Bacteria 508651
4 JGI25151J46595_10000002 3300003187 Bacteria 731381
5 JGI25153J46596_10000030 3300003215 Bacteria 200879
6 rootH1_10090042 3300003316 Bacteria 1149
7 rootH2_10249717 3300003320 Bacteria 1259
8 rootH1_10138828 3300003323 Bacteria 5080
9 rootH1_10201824 3300003323 Bacteria 4112
10 Ga0055536_1000004 3300003781 Bacteria 411108
11 Ga0055530_10008818 3300003791 Bacteria 3975
12 Ga0065714_10017373 3300005288 Bacteria 1347
13 Ga0065714_10064769 3300005288 Bacteria 19364
14 Ga0065714_10066563 3300005288 Bacteria 6647
15 Ga0070658_10070052 3300005327 Bacteria 2870
16 Ga0070680_100305286 3300005336 Bacteria 1350
17 Ga0070682_100058009 3300005337 Bacteria 2440
18 Ga0070660_100046990 3300005339 Bacteria 3310
19 Ga0070691_10249514 3300005341 Bacteria 951
20 Ga0070659_100000199 3300005366 Bacteria 46342
21 Ga0070662_100382188 3300005457 Unclassified 1159
22 Ga0070681_10144983 3300005458 Unclassified 2304
23 Ga0070679_100017477 3300005530 Bacteria 6942
24 Ga0070679_100151163 3300005530 Bacteria 2298
25 Ga0070684_100121074 3300005535 Unclassified 2354
26 Ga0068853_100074436 3300005539 Unclassified 2963
27 Ga0070693_100074102 3300005547 Bacteria 2013
28 Ga0068855_100017245 3300005563 Bacteria 8690
29 Ga0068855_100109105 3300005563 Bacteria 3179
30 Ga0068855_100114629 3300005563 Unclassified 3090
31 Ga0068855_100247342 3300005563 Unclassified 1990
32 Ga0068855_100374184 3300005563 Bacteria 1565
33 Ga0068857_100865132 3300005577 Bacteria 866
34 Ga0068854_100041315 3300005578 Bacteria 3258
35 Ga0068856_100208683 3300005614 Bacteria 1968
36 Ga0068856_100892447 3300005614 Bacteria 908
37 Ga0068852_100010311 3300005616 Bacteria 6976
38 Ga0105240_10291303 3300009093 Bacteria 1871
39 Ga0105245_10395577 3300009098 Unclassified 1380
40 Ga0105237_10003574 3300009545 Bacteria 18410
41 Ga0105237_10020776 3300009545 Bacteria 6763
42 Ga0105239_10053798 3300010375 Bacteria 4414
43 Ga0157373_10000203 3300013100 Bacteria 49252
44 Ga0157373_10010629 3300013100 Bacteria 6773
45 Ga0157373_10031280 3300013100 Bacteria 3831
46 Ga0157373_10045141 3300013100 Bacteria 3146
47 Ga0157371_10000241 3300013102 Bacteria 78231
48 Ga0157371_10010451 3300013102 Bacteria 7232
49 Ga0157370_10005174 3300013104 Bacteria 14709
50 Ga0157370_10107723 3300013104 Bacteria 2606
51 Ga0157370_10712086 3300013104 Bacteria 916
52 Ga0157369_10000023 3300013105 Bacteria 226955
53 Ga0157369_10008015 3300013105 Bacteria 12129
54 Ga0157374_10408712 3300013296 Bacteria 1355
55 Ga0163162_10000036 3300013306 Bacteria 144093
56 Ga0157372_10044110 3300013307 Bacteria 4940
57 Ga0157372_10163047 3300013307 Bacteria 2577
58 Ga0157372_10368920 3300013307 Bacteria 1673
59 Ga0157375_10188541 3300013308 Bacteria 2216
60 Ga0157375_10248953 3300013308 Bacteria 1938
61 Ga0182008_10002403 3300014497 Bacteria 11774
62 Ga0182006_1000089 3300015261 Bacteria 110375
63 Ga0182006_1000291 3300015261 Bacteria 44110
64 Ga0182007_10000038 3300015262 Bacteria 123202
65 Ga0183373_1009 3300015682 Bacteria 210158
66 Ga0163161_10000047 3300017792 Bacteria 126839
67 Ga0163161_10000319 3300017792 Bacteria 41287
68 Ga0163161_10003106 3300017792 Bacteria 11715
69 Ga0163161_10063428 3300017792 Bacteria 2693
70 Ga0163161_10135000 3300017792 Bacteria 1864
71 Ga0213876_10011996 3300021384 Bacteria 4616
72 Ga0207425_1000003 3300025245 Bacteria 1145342
73 Ga0209026_1000625 3300025250 Bacteria 22243
74 Ga0209129_1000014 3300025258 Bacteria 509018
75 Ga0209233_1003553 3300025261 Bacteria 5483
76 Ga0209676_1000009 3300025292 Bacteria 981719
77 Ga0209025_1000007 3300025294 Bacteria 1145109
78 Ga0209758_1000012 3300025297 Bacteria 949866
79 Ga0209050_1000048 3300025298 Bacteria 371553
80 Ga0207695_10107457 3300025913 Unclassified 2776
81 Ga0207671_10002963 3300025914 Bacteria 17464
82 Ga0207671_10034811 3300025914 Bacteria 3741
83 Ga0207671_10035428 3300025914 Bacteria 3704
84 Ga0207652_10153682 3300025921 Bacteria 2061
85 Ga0207690_10000744 3300025932 Bacteria 21044
86 Ga0207667_10077337 3300025949 Bacteria 3452
87 Ga0207667_10163045 3300025949 Bacteria 2292
88 Ga0207639_10266320 3300026041 Bacteria 1501
89 Ga0207702_10148922 3300026078 Bacteria 2127
90 Ga0207702_10175478 3300026078 Bacteria 1969
91 Ga0207698_10048788 3300026142 Bacteria 3217
92 Ga0207698_10049637 3300026142 Bacteria 3195
93 Ga0207698_10601740 3300026142 Bacteria 1084
94 Ga0307405_10000022 3300031731 Bacteria 148522
95 Ga0307407_10000012 3300031903 Bacteria 172479
96 Ga0307412_10148008 3300031911 Bacteria 1729
97 Ga0307416_100000024 3300032002 Bacteria 186924
98 Ga0307414_10003220 3300032004 Bacteria 8690
99 Ga0307510_10013303 3300033180 Bacteria 9757
100 Ga0395899_0000002 3300037312 Bacteria 1324310
101 Ga0436365_0442056 3300039437 Bacteria 15370
102 Ga0495650_0037707 3300046471 Bacteria 2101
103 Ga0495606_0016585 3300046507 Bacteria 5609
104 Ga0495606_0019811 3300046507 Bacteria 4984
105 Ga0495606_0053420 3300046507 Bacteria 2622
106 Ga0495610_0000130 3300046512 Bacteria 82710
107 Ga0495610_0001109 3300046512 Bacteria 24523
108 Ga0495637_0017691 3300046520 Bacteria 3316
109 Ga0495663_0119865 3300046525 Bacteria 880
110 Ga0495609_0074598 3300046538 Bacteria 1487
111 Ga0495645_0314945 3300046543 Bacteria 1018
112 Ga0495633_0000019 3300046558 Bacteria 233769
113 Ga0495661_0000919 3300046665 Bacteria 26956
114 Ga0495661_0023160 3300046665 Bacteria 4034
115 Ga0495686_0015977 3300047472 Bacteria 5103
116 Ga0495686_0094996 3300047472 Bacteria 1806
117 Ga0496126_0341294 3300048929 Bacteria 1227
118 Ga0501037_0248580 3300049573 Bacteria 1245
119 Ga0501073_0412311 3300049589 Unclassified 933
120 Ga0500581_258785 3300053089 Bacteria 724
121 Ga0500651_0014598 3300053093 Bacteria 4808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100046990 Ga0070660_1000469903 189
2 3300025913 Ga0207695_10107457 Ga0207695_101074572 195
3 3300025949 Ga0207667_10163045 Ga0207667_101630452 195
4 3300026041 Ga0207639_10266320 Ga0207639_102663201 195
5 3300026078 Ga0207702_10148922 Ga0207702_101489222 195
6 iso_pu_bacteria 2585427687 2586207583 200
7 iso_pu_bacteria 2842722452 2842724376 200
8 iso_pu_bacteria 2842909656 2842913484 200
9 iso_pu_bacteria 2738541302 2738854312 201
10 iso_pu_bacteria 2739367651 2739587834 201
11 iso_pu_bacteria 2739367663 2739646545 201
12 iso_pu_bacteria 2849281842 2849284933 201
13 iso_pu_bacteria 2857627736 2857629854 201
14 iso_pu_bacteria 2945997725 2945998785 201
15 iso_pu_bacteria 2954016120 2954021234 202
16 3300013100 Ga0157373_10000203 Ga0157373_1000020315 203
17 iso_pu_bacteria 2852623160 2852627167 203
18 iso_pu_bacteria 2884933994 2884935896 203
19 iso_pu_bacteria 2904445276 2904448409 203
20 iso_pu_bacteria 2929239360 2929244163 203
21 3300031731 Ga0307405_10000022 Ga0307405_1000002238 204
22 3300046558 Ga0495633_0000019 Ga0495633_0000019_69143_69766 204
23 3300053093 Ga0500651_0014598 Ga0500651_0014598_2174_2797 204
24 3300002773 JGI25152J39213_1000721 JGI25152J39213_100072112 205
25 3300002774 JGI25150J39212_1000003 JGI25150J39212_100000351 205
26 3300003187 JGI25151J46595_10000002 JGI25151J46595_1000000251 205
27 3300003215 JGI25153J46596_10000030 JGI25153J46596_1000003041 205
28 3300003320 rootH2_10249717 rootH2_102497171 205
29 3300003323 rootH1_10138828 rootH1_101388285 205
30 3300003781 Ga0055536_1000004 Ga0055536_10000044 205
31 3300003791 Ga0055530_10008818 Ga0055530_100088183 205
32 3300005288 Ga0065714_10064769 Ga0065714_100647697 205
33 3300009545 Ga0105237_10003574 Ga0105237_100035747 205
34 3300013100 Ga0157373_10045141 Ga0157373_100451413 205
35 3300013102 Ga0157371_10000241 Ga0157371_1000024167 205
36 3300013104 Ga0157370_10005174 Ga0157370_100051746 205
37 3300013104 Ga0157370_10107723 Ga0157370_101077233 205
38 3300013105 Ga0157369_10000023 Ga0157369_10000023112 205
39 3300013306 Ga0163162_10000036 Ga0163162_1000003684 205
40 3300013307 Ga0157372_10163047 Ga0157372_101630473 205
41 3300013308 Ga0157375_10248953 Ga0157375_102489534 205
42 3300015262 Ga0182007_10000038 Ga0182007_1000003862 205
43 3300017792 Ga0163161_10000319 Ga0163161_1000031930 205
44 3300021384 Ga0213876_10011996 Ga0213876_100119965 205
45 3300025245 Ga0207425_1000003 Ga0207425_1000003785 205
46 3300025258 Ga0209129_1000014 Ga0209129_100001448 205
47 3300025261 Ga0209233_1003553 Ga0209233_10035535 205
48 3300025292 Ga0209676_1000009 Ga0209676_1000009543 205
49 3300025294 Ga0209025_1000007 Ga0209025_1000007784 205
50 3300025297 Ga0209758_1000012 Ga0209758_1000012785 205
51 3300025298 Ga0209050_1000048 Ga0209050_1000048339 205
52 3300025914 Ga0207671_10002963 Ga0207671_1000296316 205
53 3300026142 Ga0207698_10601740 Ga0207698_106017401 205
54 3300037312 Ga0395899_0000002 Ga0395899_0000002_430795_431412 205
55 3300039437 Ga0436365_0442056 Ga0436365_0442056_6152_6778 205
56 3300046525 Ga0495663_0119865 Ga0495663_0119865_43_669 205
57 3300048929 Ga0496126_0341294 Ga0496126_0341294_140_757 205
58 3300049573 Ga0501037_0248580 Ga0501037_0248580_572_1198 205
59 3300049589 Ga0501073_0412311 Ga0501073_0412311_28_654 205
60 iso_pu_bacteria 2818991437 2819545733 205
61 3300005327 Ga0070658_10070052 Ga0070658_100700521 206
62 3300005336 Ga0070680_100305286 Ga0070680_1003052861 206
63 3300005366 Ga0070659_100000199 Ga0070659_10000019928 206
64 3300005530 Ga0070679_100151163 Ga0070679_1001511631 206
65 3300005547 Ga0070693_100074102 Ga0070693_1000741022 206
66 3300005563 Ga0068855_100114629 Ga0068855_1001146292 206
67 3300005563 Ga0068855_100374184 Ga0068855_1003741842 206
68 3300005614 Ga0068856_100208683 Ga0068856_1002086832 206
69 3300013100 Ga0157373_10010629 Ga0157373_100106293 206
70 3300013104 Ga0157370_10712086 Ga0157370_107120862 206
71 3300015261 Ga0182006_1000089 Ga0182006_10000894 206
72 3300017792 Ga0163161_10000047 Ga0163161_1000004760 206
73 3300017792 Ga0163161_10003106 Ga0163161_100031063 206
74 3300025932 Ga0207690_10000744 Ga0207690_1000074421 206
75 3300025949 Ga0207667_10077337 Ga0207667_100773374 206
76 3300026078 Ga0207702_10175478 Ga0207702_101754782 206
77 3300031911 Ga0307412_10148008 Ga0307412_101480082 206
78 3300033180 Ga0307510_10013303 Ga0307510_1001330312 206
79 3300046538 Ga0495609_0074598 Ga0495609_0074598_246_875 206
80 3300046665 Ga0495661_0023160 Ga0495661_0023160_1277_1897 206
81 3300047472 Ga0495686_0015977 Ga0495686_0015977_2947_3567 206
82 3300003323 rootH1_10201824 rootH1_102018243 207
83 3300005288 Ga0065714_10017373 Ga0065714_100173732 207
84 3300005563 Ga0068855_100247342 Ga0068855_1002473422 207
85 3300005577 Ga0068857_100865132 Ga0068857_1008651321 207
86 3300005614 Ga0068856_100892447 Ga0068856_1008924472 207
87 3300014497 Ga0182008_10002403 Ga0182008_1000240313 207
88 3300015261 Ga0182006_1000291 Ga0182006_100029122 207
89 3300015682 Ga0183373_1009 Ga0183373_1009153 207
90 3300017792 Ga0163161_10063428 Ga0163161_100634282 207
91 3300017792 Ga0163161_10135000 Ga0163161_101350001 207
92 3300031903 Ga0307407_10000012 Ga0307407_1000001231 207
93 3300032002 Ga0307416_100000024 Ga0307416_10000002494 207
94 3300032004 Ga0307414_10003220 Ga0307414_100032206 207
95 3300046512 Ga0495610_0000130 Ga0495610_0000130_27366_27998 207
96 3300046512 Ga0495610_0001109 Ga0495610_0001109_17120_17752 207
97 3300046543 Ga0495645_0314945 Ga0495645_0314945_146_775 207
98 3300046665 Ga0495661_0000919 Ga0495661_0000919_5637_6281 207
99 3300047472 Ga0495686_0094996 Ga0495686_0094996_1148_1771 207
100 3300053089 Ga0500581_258785 Ga0500581_258785_44_676 207
101 3300003316 rootH1_10090042 rootH1_100900422 208
102 3300005288 Ga0065714_10066563 Ga0065714_100665634 208
103 3300005337 Ga0070682_100058009 Ga0070682_1000580092 208
104 3300005341 Ga0070691_10249514 Ga0070691_102495142 208
105 3300005458 Ga0070681_10144983 Ga0070681_101449832 208
106 3300005530 Ga0070679_100017477 Ga0070679_1000174773 208
107 3300005535 Ga0070684_100121074 Ga0070684_1001210742 208
108 3300005539 Ga0068853_100074436 Ga0068853_1000744363 208
109 3300005563 Ga0068855_100017245 Ga0068855_1000172454 208
110 3300005563 Ga0068855_100109105 Ga0068855_1001091053 208
111 3300005578 Ga0068854_100041315 Ga0068854_1000413153 208
112 3300005616 Ga0068852_100010311 Ga0068852_1000103113 208
113 3300009093 Ga0105240_10291303 Ga0105240_102913032 208
114 3300009545 Ga0105237_10020776 Ga0105237_100207763 208
115 3300010375 Ga0105239_10053798 Ga0105239_100537983 208
116 3300013100 Ga0157373_10031280 Ga0157373_100312804 208
117 3300013102 Ga0157371_10010451 Ga0157371_100104512 208
118 3300013105 Ga0157369_10008015 Ga0157369_100080159 208
119 3300013307 Ga0157372_10044110 Ga0157372_100441103 208
120 3300013308 Ga0157375_10188541 Ga0157375_101885413 208
121 3300025914 Ga0207671_10034811 Ga0207671_100348113 208
122 3300025921 Ga0207652_10153682 Ga0207652_101536823 208
123 3300026142 Ga0207698_10049637 Ga0207698_100496372 208
124 3300046471 Ga0495650_0037707 Ga0495650_0037707_27_659 208
125 3300046507 Ga0495606_0016585 Ga0495606_0016585_1657_2310 208
126 3300046507 Ga0495606_0019811 Ga0495606_0019811_4253_4879 208
127 3300046520 Ga0495637_0017691 Ga0495637_0017691_1225_1863 208
128 3300002741 JGI25157J39369_1005483 JGI25157J39369_10054833 209
129 3300005457 Ga0070662_100382188 Ga0070662_1003821882 209
130 3300009098 Ga0105245_10395577 Ga0105245_103955772 209
131 3300013296 Ga0157374_10408712 Ga0157374_104087121 209
132 3300013307 Ga0157372_10368920 Ga0157372_103689202 209
133 3300025250 Ga0209026_1000625 Ga0209026_100062510 209
134 3300025914 Ga0207671_10035428 Ga0207671_100354283 209
135 3300026142 Ga0207698_10048788 Ga0207698_100487883 209
136 3300046507 Ga0495606_0053420 Ga0495606_0053420_1103_1744 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

74

169

0.93

PF08241

Methyltransf_11

Methyltransferase domain

75

173

0.91

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

29

211

0.83

PF01564

Spermine_synth

Spermine/spermidine synthase domain

60

184

0.82

PF08242

Methyltransf_12

Methyltransferase domain

75

171

0.82

PF13847

Methyltransf_31

Methyltransferase domain

68

214

0.8

PF13489

Methyltransf_23

Methyltransferase domain

53

223

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.7808 9 206
3ujb-assembly2.cif.gz_B phosphoethanolamine methyltransferase from plasmodium falciparum in complex with sah and phosphoethanolamine 0.773 20 192
3dtn-assembly1.cif.gz_B crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.7607 10 206
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.7578 21 206
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.7543 8 143
ID Description Score Start End Superfamily
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8454 29 148 3.40.50.150
af_Q8IJC4_363_592_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8294 26 149 3.40.50.150
af_Q6EQW4_99_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8267 29 79 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.818 36 148 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8145 29 148 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A316AJV7-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methylase UbiE 0.9806 1 206 GO:0008168
GO:0032259
AF-A0A3D8Y3Y6-F1-model_v4 Methyltransferase type 12 0.9804 1 209 GO:0008168
GO:0032259
AF-A0A4Q3F895-F1-model_v4 Methyltransferase domain-containing protein 0.9793 1 206 GO:0008168
GO:0032259
AF-A0A512B7I2-F1-model_v4 Methyltransferase domain-containing protein 0.9765 1 209
AF-A0A3D8Y3Y6-F1-model_v4 Methyltransferase type 12 0.9758 1 209 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map