F167727

General Info

Members Datasets Scaffolds Average Seq Length
136 92 272 131

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0223396|Ga0495674_0223396_790_1233
Length 147
Sequence VPRGLPLIPQEAHIAAMGEIVHPLRRSVFRGLAGRCPACGKAPLFWRYLKVNGRCEACDTDLARYPADDGPAYLTILLIGHLVVAPMLFFPIVWRSNPAYSLPLILVPLAALTLAVLPRVKGGWVGMMYALGVKNTDDALHTADAAD

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
65 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
75 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
89 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
90 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
91 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
92 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.91
Nodule 0
Rhizoplane 1.47
Rhizosphere 77.94
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0223396 3300047319 Bacteria 1556
2 Ga0055530_10000045 3300003791 Bacteria 109202
3 Ga0055530_10003862 3300003791 Bacteria 8209
4 Ga0055531_10007053 3300003794 Bacteria 6219
5 Ga0055531_10053217 3300003794 Bacteria 1047
6 Ga0055543_1012905 3300004625 Bacteria 1666
7 Ga0065165_1000779 3300005262 Bacteria 42728
8 Ga0070658_10112794 3300005327 Bacteria 2254
9 Ga0070658_10119015 3300005327 Bacteria 2194
10 Ga0070658_11041111 3300005327 Bacteria 712
11 Ga0070658_11098528 3300005327 Bacteria 692
12 Ga0070670_100943756 3300005331 Bacteria 783
13 Ga0070666_10030807 3300005335 Bacteria 3537
14 Ga0070659_100000274 3300005366 Bacteria 40352
15 Ga0070681_10016320 3300005458 Bacteria 7412
16 Ga0070681_11571783 3300005458 Bacteria 583
17 Ga0070684_100966286 3300005535 Bacteria 799
18 Ga0068855_100341899 3300005563 Bacteria 1650
19 Ga0068855_101185487 3300005563 Bacteria 795
20 Ga0068856_100268489 3300005614 Bacteria 1722
21 Ga0068852_101527678 3300005616 Bacteria 690
22 Ga0068863_100067530 3300005841 Bacteria 3382
23 Ga0068858_101055561 3300005842 Unclassified 797
24 Ga0068862_100100668 3300005844 Bacteria 2527
25 Ga0068862_100655024 3300005844 Bacteria 1013
26 Ga0070717_10073288 3300006028 Bacteria 2861
27 Ga0070717_10822520 3300006028 Bacteria 845
28 Ga0075365_10192425 3300006038 Bacteria 1428
29 Ga0075362_10367123 3300006177 Bacteria 722
30 Ga0075370_10256790 3300006353 Unclassified 1036
31 Ga0068865_100135572 3300006881 Bacteria 1849
32 Ga0105240_10010620 3300009093 Bacteria 12937
33 Ga0105240_10137566 3300009093 Bacteria 2924
34 Ga0105240_10561794 3300009093 Bacteria 1261
35 Ga0105240_10842940 3300009093 Bacteria 990
36 Ga0105245_10299806 3300009098 Bacteria 1577
37 Ga0105248_10006407 3300009177 Bacteria 12913
38 Ga0105237_10271889 3300009545 Bacteria 1697
39 Ga0105238_10006090 3300009551 Bacteria 11964
40 Ga0105238_10059494 3300009551 Bacteria 3827
41 Ga0105238_10407117 3300009551 Bacteria 1354
42 Ga0105238_10675154 3300009551 Bacteria 1044
43 Ga0105238_10901520 3300009551 Bacteria 903
44 Ga0105239_10204672 3300010375 Bacteria 2212
45 Ga0157369_11785051 3300013105 Bacteria 625
46 Ga0163162_10324654 3300013306 Bacteria 1671
47 Ga0163162_11134039 3300013306 Bacteria 886
48 Ga0163163_10263856 3300014325 Bacteria 1773
49 Ga0157377_11148471 3300014745 Bacteria 598
50 Ga0209026_1001493 3300025250 Bacteria 10259
51 Ga0209148_1011388 3300025254 Bacteria 1654
52 Ga0209148_1017993 3300025254 Bacteria 1192
53 Ga0209758_1001715 3300025297 Bacteria 24542
54 Ga0209050_1000121 3300025298 Bacteria 196019
55 Ga0209050_1095911 3300025298 Bacteria 597
56 Ga0209257_1000125 3300025304 Bacteria 218126
57 Ga0209257_1000888 3300025304 Bacteria 41959
58 Ga0207680_10178443 3300025903 Bacteria 1435
59 Ga0207705_10097684 3300025909 Bacteria 2157
60 Ga0207705_10215075 3300025909 Bacteria 1458
61 Ga0207705_10629473 3300025909 Bacteria 834
62 Ga0207654_10329495 3300025911 Bacteria 1046
63 Ga0207695_10000841 3300025913 Bacteria 56351
64 Ga0207695_10053715 3300025913 Bacteria 4211
65 Ga0207649_10716517 3300025920 Bacteria 777
66 Ga0207652_10093740 3300025921 Bacteria 2643
67 Ga0207694_10012024 3300025924 Bacteria 6526
68 Ga0207694_10206643 3300025924 Bacteria 1599
69 Ga0207694_10400027 3300025924 Bacteria 1142
70 Ga0207694_10423609 3300025924 Bacteria 1109
71 Ga0207694_10907869 3300025924 Bacteria 745
72 Ga0207704_10003108 3300025938 Bacteria 7505
73 Ga0207704_10694398 3300025938 Bacteria 842
74 Ga0207711_10023550 3300025941 Bacteria 5154
75 Ga0207667_10205275 3300025949 Bacteria 2021
76 Ga0207667_10614003 3300025949 Bacteria 1095
77 Ga0207640_10288997 3300025981 Bacteria 1292
78 Ga0207703_10626487 3300026035 Bacteria 1019
79 Ga0207641_10054632 3300026088 Bacteria 3390
80 Ga0207676_10514322 3300026095 Bacteria 1139
81 Ga0268265_10079601 3300028380 Bacteria 2581
82 Ga0307517_10209717 3300028786 Bacteria 1202
83 Ga0307515_10633903 3300028794 Bacteria 681
84 Ga0307511_10040403 3300030521 Bacteria 3963
85 Ga0307413_10342752 3300031824 Bacteria 1150
86 Ga0307411_10436115 3300032005 Bacteria 1092
87 Ga0395899_0000364 3300037312 Bacteria 54980
88 Ga0395899_0116118 3300037312 Bacteria 1920
89 Ga0395900_0000052 3300037418 Bacteria 223910
90 Ga0395900_0088877 3300037418 Bacteria 3176
91 Ga0395900_0759341 3300037418 Bacteria 899
92 Ga0395900_1120022 3300037418 Bacteria 704
93 Ga0395898_0034288 3300037466 Bacteria 5060
94 Ga0395898_0179939 3300037466 Bacteria 2021
95 Ga0395898_0271161 3300037466 Bacteria 1618
96 Ga0395898_0783749 3300037466 Bacteria 894
97 Ga0395905_0007378 3300037471 Bacteria 10938
98 Ga0395905_0188635 3300037471 Bacteria 1935
99 Ga0395905_0345413 3300037471 Bacteria 1380
100 Ga0395905_0662792 3300037471 Bacteria 945
101 Ga0395905_1809229 3300037471 Bacteria 516
102 Ga0395901_0000001 3300038443 Bacteria 800383
103 Ga0395901_0229366 3300038443 Bacteria 1939
104 Ga0436365_0733881 3300039437 Bacteria 559
105 Ga0439465_0158034 3300041413 Bacteria 812
106 Ga0451804_0113563 3300041463 Bacteria 617
107 Ga0439431_0144558 3300041997 Bacteria 673
108 Ga0439445_0008903 3300042004 Bacteria 2358
109 Ga0466957_0151722 3300044842 Bacteria 1499
110 Ga0495650_0062051 3300046471 Bacteria 1495
111 Ga0495630_0365055 3300046517 Bacteria 1105
112 Ga0495645_0041477 3300046543 Bacteria 3356
113 Ga0495668_0077552 3300046616 Bacteria 1824
114 Ga0495668_0205335 3300046616 Unclassified 1079
115 Ga0495668_0247029 3300046616 Bacteria 977
116 Ga0495625_0265149 3300046660 Bacteria 1110
117 Ga0495599_0565652 3300046678 Bacteria 665
118 Ga0495623_0321900 3300046679 Bacteria 849
119 Ga0495658_0289035 3300046683 Bacteria 1036
120 Ga0495669_0054108 3300046684 Bacteria 1806
121 Ga0495686_0001454 3300047472 Bacteria 25799
122 Ga0496112_0159729 3300048915 Bacteria 2220
123 Ga0501032_0111481 3300049569 Bacteria 1810
124 Ga0501034_0968945 3300049571 Bacteria 736
125 Ga0501043_0838014 3300049579 Bacteria 663
126 Ga0501047_0017583 3300049581 Bacteria 6851
127 Ga0501047_0171788 3300049581 Bacteria 2036
128 Ga0501048_0352343 3300049582 Bacteria 1050
129 Ga0501044_0325449 3300049823 Bacteria 1461
130 nmdc:mga0yw44_393792_c1 3300050492 Bacteria 936
131 nmdc:mga07m45_362683_c1 3300050496 Unclassified 842
132 Ga0500562_000699 3300053108 Bacteria 8186
133 Ga0500597_402439 3300053120 Bacteria 520
134 Ga0500642_0258308 3300053130 Bacteria 798
135 Ga0500603_179409 3300053150 Bacteria 666
136 Ga0500645_005247 3300053730 Bacteria 4810
137 Ga0495674_0223396
138 Ga0055530_10000045
139 Ga0055530_10003862
140 Ga0055531_10007053
141 Ga0055531_10053217
142 Ga0055543_1012905
143 Ga0065165_1000779
144 Ga0070658_10112794
145 Ga0070658_10119015
146 Ga0070658_11041111
147 Ga0070658_11098528
148 Ga0070670_100943756
149 Ga0070666_10030807
150 Ga0070659_100000274
151 Ga0070681_10016320
152 Ga0070681_11571783
153 Ga0070684_100966286
154 Ga0068855_100341899
155 Ga0068855_101185487
156 Ga0068856_100268489
157 Ga0068852_101527678
158 Ga0068863_100067530
159 Ga0068858_101055561
160 Ga0068862_100100668
161 Ga0068862_100655024
162 Ga0070717_10073288
163 Ga0070717_10822520
164 Ga0075365_10192425
165 Ga0075362_10367123
166 Ga0075370_10256790
167 Ga0068865_100135572
168 Ga0105240_10010620
169 Ga0105240_10137566
170 Ga0105240_10561794
171 Ga0105240_10842940
172 Ga0105245_10299806
173 Ga0105248_10006407
174 Ga0105237_10271889
175 Ga0105238_10006090
176 Ga0105238_10059494
177 Ga0105238_10407117
178 Ga0105238_10675154
179 Ga0105238_10901520
180 Ga0105239_10204672
181 Ga0157369_11785051
182 Ga0163162_10324654
183 Ga0163162_11134039
184 Ga0163163_10263856
185 Ga0157377_11148471
186 Ga0209026_1001493
187 Ga0209148_1011388
188 Ga0209148_1017993
189 Ga0209758_1001715
190 Ga0209050_1000121
191 Ga0209050_1095911
192 Ga0209257_1000125
193 Ga0209257_1000888
194 Ga0207680_10178443
195 Ga0207705_10097684
196 Ga0207705_10215075
197 Ga0207705_10629473
198 Ga0207654_10329495
199 Ga0207695_10000841
200 Ga0207695_10053715
201 Ga0207649_10716517
202 Ga0207652_10093740
203 Ga0207694_10012024
204 Ga0207694_10206643
205 Ga0207694_10400027
206 Ga0207694_10423609
207 Ga0207694_10907869
208 Ga0207704_10003108
209 Ga0207704_10694398
210 Ga0207711_10023550
211 Ga0207667_10205275
212 Ga0207667_10614003
213 Ga0207640_10288997
214 Ga0207703_10626487
215 Ga0207641_10054632
216 Ga0207676_10514322
217 Ga0268265_10079601
218 Ga0307517_10209717
219 Ga0307515_10633903
220 Ga0307511_10040403
221 Ga0307413_10342752
222 Ga0307411_10436115
223 Ga0395899_0000364
224 Ga0395899_0116118
225 Ga0395900_0000052
226 Ga0395900_0088877
227 Ga0395900_0759341
228 Ga0395900_1120022
229 Ga0395898_0034288
230 Ga0395898_0179939
231 Ga0395898_0271161
232 Ga0395898_0783749
233 Ga0395905_0007378
234 Ga0395905_0188635
235 Ga0395905_0345413
236 Ga0395905_0662792
237 Ga0395905_1809229
238 Ga0395901_0000001
239 Ga0395901_0229366
240 Ga0436365_0733881
241 Ga0439465_0158034
242 Ga0451804_0113563
243 Ga0439431_0144558
244 Ga0439445_0008903
245 Ga0466957_0151722
246 Ga0495650_0062051
247 Ga0495630_0365055
248 Ga0495645_0041477
249 Ga0495668_0077552
250 Ga0495668_0205335
251 Ga0495668_0247029
252 Ga0495625_0265149
253 Ga0495599_0565652
254 Ga0495623_0321900
255 Ga0495658_0289035
256 Ga0495669_0054108
257 Ga0495686_0001454
258 Ga0496112_0159729
259 Ga0501032_0111481
260 Ga0501034_0968945
261 Ga0501043_0838014
262 Ga0501047_0017583
263 Ga0501047_0171788
264 Ga0501048_0352343
265 Ga0501044_0325449
266 nmdc:mga0yw44_393792_c1
267 nmdc:mga07m45_362683_c1
268 Ga0500562_000699
269 Ga0500597_402439
270 Ga0500642_0258308
271 Ga0500603_179409
272 Ga0500645_005247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

45

129

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_P0DMQ8_1_134_1.10.287.970 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;His Kinase A (phosphoacceptor) domain 0.5632 54 130 1.10.287.970
af_Q6UX98_91_234_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2101 32 128 1.10.287.70
af_Q6UX98_91_234_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.1773 32 128 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A6B3UHN8-F1-model_v4 DUF983 domain-containing protein 0.9676 10 121 GO:0016020
AF-A0A6M5J6T5-F1-model_v4 DUF983 domain-containing protein 0.9472 10 117 GO:0016020
AF-A0A7W9AJS6-F1-model_v4 Uncharacterized protein (DUF983 family) 0.9414 8 119 GO:0016020
AF-A0A257X613-F1-model_v4 DUF983 domain-containing protein 0.9335 14 126 GO:0016020
AF-A0A0Q8M3Q7-F1-model_v4 Zinc-finger protein 0.9266 10 134 GO:0016020

Map