F167507

General Info

Members Datasets Scaffolds Average Seq Length
136 103 119 292

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0002023|Ga0466959_0002023_7546_8502
Length 318
Sequence LNAAAGGWRKTADSAKMLVYPHVACRMSSRILSIILPVLLIVAIGWLYGKRRQPDMSAANRLNMEVTVPLLVFSVLAAKDFDLAAQWKLVPASFGVILLSGLLTWPVARLARISPRTLLPPMMFNNNGNMGLPLALLAFGHAGFSAFVVPFAISNLLHFTLGAWLFDKKTRLAGLARNPIVLASLAGTVVGLLRVTLPDWLMFAISMLGNVSMPMMLFALGVRMVDVDFSSWRAGLLGAVLCPLTGLLAASLIAPALQLGPLHTQLLYLFGALPPAVLNFLMAEHYRREPERMASIVLIGNMASVLFVPFGLWLAFLK

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
6 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
7 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
8 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
9 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
10 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
11 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
12 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
13 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
14 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
52 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
64 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
101 639633007 Azoarcus olearius BH72 Isolate Unclassified
102 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
103 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.32
Nodule 3.68
Rhizoplane 0.74
Rhizosphere 59.56
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001614 3300003187 Bacteria 14947
2 JGI25151J46595_10002516 3300003187 Bacteria 10893
3 Ga0055526_1010217 3300003771 Bacteria 4393
4 Ga0055526_1017710 3300003771 Bacteria 2706
5 Ga0055526_1024304 3300003771 Bacteria 1988
6 Ga0055537_1003643 3300003773 Bacteria 4672
7 Ga0055524_1000606 3300003775 Bacteria 25747
8 Ga0055524_1024706 3300003775 Bacteria 1898
9 Ga0055536_1000074 3300003781 Bacteria 84660
10 Ga0055534_1000580 3300003784 Bacteria 19219
11 Ga0055534_1015423 3300003784 Bacteria 1400
12 Ga0070659_100133739 3300005366 Bacteria 2016
13 Ga0068853_100193432 3300005539 Bacteria 1849
14 Ga0070716_100039369 3300006173 Unclassified 2624
15 Ga0075367_10139797 3300006178 Bacteria 1500
16 Ga0075430_100012471 3300006846 Bacteria 7233
17 Ga0099826_10000015 3300006948 Bacteria 254837
18 Ga0105237_10083653 3300009545 Bacteria 3182
19 Ga0157370_10002810 3300013104 Bacteria 20794
20 Ga0157370_10024825 3300013104 Bacteria 5935
21 Ga0182008_10063029 3300014497 Bacteria 1826
22 Ga0209565_1000267 3300025263 Bacteria 54064
23 Ga0209673_1028085 3300025273 Bacteria 1819
24 Ga0209675_1000210 3300025291 Bacteria 61408
25 Ga0209675_1001891 3300025291 Bacteria 11287
26 Ga0209676_1000012 3300025292 Bacteria 841431
27 Ga0209025_1000306 3300025294 Bacteria 109280
28 Ga0209025_1000849 3300025294 Bacteria 48335
29 Ga0209025_1001305 3300025294 Bacteria 34015
30 Ga0209025_1007105 3300025294 Bacteria 8467
31 Ga0209564_1001057 3300025295 Bacteria 33550
32 Ga0209564_1001897 3300025295 Bacteria 18742
33 Ga0209564_1002568 3300025295 Bacteria 13965
34 Ga0209758_1006034 3300025297 Bacteria 8941
35 Ga0209256_1000059 3300025299 Bacteria 272170
36 Ga0209256_1002918 3300025299 Bacteria 12875
37 Ga0207671_10214873 3300025914 Bacteria 1505
38 Ga0207650_10010958 3300025925 Bacteria 6231
39 Ga0207665_10054688 3300025939 Unclassified 2692
40 Ga0207658_10113477 3300025986 Bacteria 2147
41 Ga0207639_10170749 3300026041 Bacteria 1842
42 Ga0209970_1000265 3300027614 Bacteria 8626
43 Ga0209282_1000031 3300027666 Bacteria 150666
44 Ga0265332_10000029 3300031238 Bacteria 180902
45 Ga0265316_10108587 3300031344 Bacteria 2103
46 Ga0265316_10189338 3300031344 Bacteria 1529
47 Ga0307509_10000018 3300031507 Bacteria 258998
48 Ga0307508_10030873 3300031616 Bacteria 4843
49 Ga0316576_10014090 3300031727 Bacteria 5333
50 Ga0307416_100328556 3300032002 Bacteria 1535
51 Ga0316583_10000474 3300032133 Bacteria 11917
52 Ga0373951_0010720 3300035091 Bacteria 2059
53 Ga0373947_0077833 3300035725 Bacteria 2046
54 Ga0373937_0352356 3300036401 Bacteria 1394
55 Ga0316582_0003896 3300036647 Bacteria 7436
56 Ga0316584_0059304 3300036712 Bacteria 2866
57 Ga0395899_0181639 3300037312 Bacteria 1477
58 Ga0395898_0004394 3300037466 Bacteria 15422
59 Ga0395898_0182149 3300037466 Bacteria 2008
60 Ga0395905_0000138 3300037471 Bacteria 120373
61 Ga0395905_0000583 3300037471 Bacteria 49151
62 Ga0395905_0024266 3300037471 Bacteria 5724
63 Ga0395905_0255576 3300037471 Bacteria 1636
64 Ga0400483_038816 3300039062 Bacteria 1415
65 Ga0400483_164273 3300039062 Bacteria 103284
66 Ga0400483_189922 3300039062 Bacteria 4582
67 Ga0439433_0018163 3300041999 Bacteria 1564
68 Ga0439449_0009061 3300042007 Bacteria 3775
69 Ga0450911_009487 3300042115 Bacteria 1363
70 Ga0450893_0000689 3300042532 Bacteria 4888
71 Ga0451577_0002460 3300042876 Bacteria 22039
72 Ga0451577_0068426 3300042876 Bacteria 3166
73 Ga0466972_0062063 3300044658 Bacteria 1791
74 Ga0453683_0340056 3300044673 Bacteria 963
75 Ga0466965_0152656 3300044683 Bacteria 1207
76 Ga0466961_0000588 3300044693 Bacteria 23034
77 Ga0453684_0000014 3300044712 Bacteria 993311
78 Ga0453684_0002735 3300044712 Bacteria 41744
79 Ga0453684_0008985 3300044712 Bacteria 17656
80 Ga0453684_0010827 3300044712 Bacteria 15457
81 Ga0453684_0563265 3300044712 Bacteria 1253
82 Ga0466970_0111212 3300044765 Bacteria 1496
83 Ga0466957_0094289 3300044842 Bacteria 1879
84 Ga0466959_0002023 3300045049 Bacteria 12809
85 Ga0451576_0000305 3300045051 Bacteria 119146
86 Ga0451576_0006051 3300045051 Bacteria 14935
87 Ga0451576_0048506 3300045051 Bacteria 4460
88 Ga0495605_0006676 3300046474 Bacteria 6607
89 Ga0495596_0000592 3300046500 Bacteria 22695
90 Ga0495607_0020290 3300046501 Bacteria 4205
91 Ga0495606_0001486 3300046507 Bacteria 31202
92 Ga0495606_0256590 3300046507 Bacteria 967
93 Ga0495610_0004840 3300046512 Bacteria 9809
94 Ga0495643_0000148 3300046522 Bacteria 113969
95 Ga0495648_0050697 3300046524 Bacteria 2534
96 Ga0495654_0016463 3300046530 Bacteria 3908
97 Ga0495609_0002461 3300046538 Bacteria 11383
98 Ga0495625_0040178 3300046660 Bacteria 3414
99 Ga0495661_0004338 3300046665 Bacteria 10263
100 Ga0495671_0000686 3300046692 Bacteria 24514
101 Ga0495671_0000918 3300046692 Bacteria 20886
102 Ga0495649_0000575 3300046694 Bacteria 30846
103 Ga0495649_0031759 3300046694 Bacteria 2911
104 Ga0495649_0048519 3300046694 Bacteria 2307
105 Ga0495649_0127682 3300046694 Bacteria 1342
106 Ga0495660_0029643 3300046810 Bacteria 3086
107 Ga0495636_0017936 3300047318 Bacteria 2837
108 Ga0495672_0152671 3300047320 Bacteria 1196
109 Ga0496114_0010656 3300048917 Bacteria 7317
110 Ga0496121_0013668 3300048924 Bacteria 8703
111 Ga0496122_0001513 3300048925 Bacteria 37053
112 Ga0496123_0008339 3300048926 Bacteria 9535
113 Ga0496125_0000455 3300048928 Bacteria 73934
114 Ga0501034_0000188 3300049571 Bacteria 115935
115 Ga0501034_0145806 3300049571 Bacteria 2345
116 Ga0501209_000044 3300049656 Bacteria 11945
117 nmdc:mga06z11_161658_c1 3300050494 Bacteria 1280
118 nmdc:mga0qj67_418535_c1 3300050509 Bacteria 1080
119 Ga0500651_0007678 3300053093 Bacteria 6307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0256590 Ga0495606_0256590_14_808 264
2 3300050509 nmdc:mga0qj67_418535_c1 nmdc:mga0qj67_418535_c1_82_957 269
3 3300044712 Ga0453684_0008985 Ga0453684_0008985_1746_2633 271
4 3300045051 Ga0451576_0000305 Ga0451576_0000305_110219_111106 271
5 3300045051 Ga0451576_0006051 Ga0451576_0006051_7961_8848 273
6 3300042115 Ga0450911_009487 Ga0450911_009487_126_1004 274
7 3300042876 Ga0451577_0002460 Ga0451577_0002460_8899_9792 274
8 3300044712 Ga0453684_0000014 Ga0453684_0000014_239892_240785 274
9 3300037471 Ga0395905_0000583 Ga0395905_0000583_36455_37360 275
10 3300032133 Ga0316583_10000474 Ga0316583_100004748 278
11 3300044693 Ga0466961_0000588 Ga0466961_0000588_17230_18138 278
12 3300049571 Ga0501034_0145806 Ga0501034_0145806_785_1672 278
13 3300044658 Ga0466972_0062063 Ga0466972_0062063_677_1555 283
14 3300050494 nmdc:mga06z11_161658_c1 nmdc:mga06z11_161658_c1_419_1270 283
15 iso_pu_bacteria 2919543075 2919543424 286
16 iso_pu_bacteria 2923525760 2923528421 286
17 iso_pu_bacteria 639633007 639785536 286
18 iso_pu_bacteria 2526164512 2526210495 287
19 iso_pu_bacteria 2547132512 2548848523 287
20 iso_pu_bacteria 2574179768 2574429448 287
21 iso_pu_bacteria 2738543020 2739289136 287
22 iso_pu_bacteria 2738543021 2739294448 287
23 iso_pu_bacteria 2842805378 2842808982 287
24 iso_pu_bacteria 2998344455 2998346853 287
25 3300039062 Ga0400483_038816 Ga0400483_038816_58_924 288
26 iso_pu_bacteria 2919704043 2919705305 288
27 3300031727 Ga0316576_10014090 Ga0316576_100140904 289
28 3300036647 Ga0316582_0003896 Ga0316582_0003896_2518_3387 289
29 3300036712 Ga0316584_0059304 Ga0316584_0059304_1481_2350 289
30 iso_pu_bacteria 2513237150 2513955922 289
31 iso_pu_bacteria 2513237165 2514043991 289
32 iso_pu_bacteria 2834641062 2834644841 289
33 iso_pu_bacteria 2901300506 2901303543 289
34 iso_pu_bacteria 8003400568 8003401804 289
35 3300005366 Ga0070659_100133739 Ga0070659_1001337392 290
36 3300005539 Ga0068853_100193432 Ga0068853_1001934322 290
37 3300006178 Ga0075367_10139797 Ga0075367_101397972 290
38 3300014497 Ga0182008_10063029 Ga0182008_100630292 290
39 3300026041 Ga0207639_10170749 Ga0207639_101707492 290
40 3300027614 Ga0209970_1000265 Ga0209970_10002653 290
41 3300031344 Ga0265316_10108587 Ga0265316_101085872 290
42 3300031344 Ga0265316_10189338 Ga0265316_101893382 290
43 3300031616 Ga0307508_10030873 Ga0307508_100308732 290
44 3300035091 Ga0373951_0010720 Ga0373951_0010720_811_1698 290
45 3300037312 Ga0395899_0181639 Ga0395899_0181639_480_1358 290
46 3300037466 Ga0395898_0004394 Ga0395898_0004394_12062_12940 290
47 3300037471 Ga0395905_0000138 Ga0395905_0000138_96828_97706 290
48 3300037471 Ga0395905_0024266 Ga0395905_0024266_3311_4189 290
49 3300039062 Ga0400483_189922 Ga0400483_189922_3469_4341 290
50 3300041999 Ga0439433_0018163 Ga0439433_0018163_347_1231 290
51 3300042007 Ga0439449_0009061 Ga0439449_0009061_23_907 290
52 3300042532 Ga0450893_0000689 Ga0450893_0000689_761_1639 290
53 3300042876 Ga0451577_0068426 Ga0451577_0068426_2205_3092 290
54 3300044712 Ga0453684_0002735 Ga0453684_0002735_24107_24994 290
55 3300044712 Ga0453684_0010827 Ga0453684_0010827_13577_14464 290
56 3300044765 Ga0466970_0111212 Ga0466970_0111212_532_1410 290
57 3300045051 Ga0451576_0048506 Ga0451576_0048506_3286_4173 290
58 3300053093 Ga0500651_0007678 Ga0500651_0007678_1972_2850 290
59 3300006173 Ga0070716_100039369 Ga0070716_1000393692 291
60 3300006846 Ga0075430_100012471 Ga0075430_1000124713 291
61 3300009545 Ga0105237_10083653 Ga0105237_100836534 291
62 3300013104 Ga0157370_10002810 Ga0157370_100028109 291
63 3300013104 Ga0157370_10024825 Ga0157370_100248254 291
64 3300025914 Ga0207671_10214873 Ga0207671_102148732 291
65 3300025925 Ga0207650_10010958 Ga0207650_100109582 291
66 3300025939 Ga0207665_10054688 Ga0207665_100546882 291
67 3300025986 Ga0207658_10113477 Ga0207658_101134772 291
68 3300031238 Ga0265332_10000029 Ga0265332_10000029155 291
69 3300031507 Ga0307509_10000018 Ga0307509_10000018240 291
70 3300032002 Ga0307416_100328556 Ga0307416_1003285562 291
71 3300035725 Ga0373947_0077833 Ga0373947_0077833_455_1330 291
72 3300036401 Ga0373937_0352356 Ga0373937_0352356_212_1087 291
73 3300037466 Ga0395898_0182149 Ga0395898_0182149_971_1858 291
74 3300037471 Ga0395905_0255576 Ga0395905_0255576_349_1236 291
75 3300039062 Ga0400483_164273 Ga0400483_164273_17836_18777 291
76 3300044673 Ga0453683_0340056 Ga0453683_0340056_59_934 291
77 3300044683 Ga0466965_0152656 Ga0466965_0152656_131_1042 291
78 3300044712 Ga0453684_0563265 Ga0453684_0563265_257_1138 291
79 3300044842 Ga0466957_0094289 Ga0466957_0094289_338_1249 291
80 3300045049 Ga0466959_0002023 Ga0466959_0002023_7546_8502 291
81 3300046507 Ga0495606_0001486 Ga0495606_0001486_10371_11270 291
82 3300046522 Ga0495643_0000148 Ga0495643_0000148_90931_91830 291
83 3300046530 Ga0495654_0016463 Ga0495654_0016463_72_971 291
84 3300046660 Ga0495625_0040178 Ga0495625_0040178_2267_3166 291
85 3300046692 Ga0495671_0000918 Ga0495671_0000918_13757_14656 291
86 3300046694 Ga0495649_0000575 Ga0495649_0000575_20001_20900 291
87 3300046694 Ga0495649_0031759 Ga0495649_0031759_628_1527 291
88 3300046694 Ga0495649_0127682 Ga0495649_0127682_160_1059 291
89 3300046810 Ga0495660_0029643 Ga0495660_0029643_90_995 291
90 3300048917 Ga0496114_0010656 Ga0496114_0010656_4760_5680 291
91 3300048928 Ga0496125_0000455 Ga0496125_0000455_32466_33386 291
92 3300049656 Ga0501209_000044 Ga0501209_000044_3402_4277 291
93 3300003187 JGI25151J46595_10001614 JGI25151J46595_1000161414 293
94 3300003187 JGI25151J46595_10002516 JGI25151J46595_1000251610 293
95 3300003771 Ga0055526_1010217 Ga0055526_10102172 293
96 3300003771 Ga0055526_1017710 Ga0055526_10177102 293
97 3300003771 Ga0055526_1024304 Ga0055526_10243042 293
98 3300003773 Ga0055537_1003643 Ga0055537_10036433 293
99 3300003775 Ga0055524_1000606 Ga0055524_100060611 293
100 3300003775 Ga0055524_1024706 Ga0055524_10247062 293
101 3300003781 Ga0055536_1000074 Ga0055536_100007414 293
102 3300003784 Ga0055534_1000580 Ga0055534_10005808 293
103 3300003784 Ga0055534_1015423 Ga0055534_10154231 293
104 3300006948 Ga0099826_10000015 Ga0099826_1000001577 293
105 3300025263 Ga0209565_1000267 Ga0209565_100026729 293
106 3300025273 Ga0209673_1028085 Ga0209673_10280852 293
107 3300025291 Ga0209675_1000210 Ga0209675_100021014 293
108 3300025291 Ga0209675_1001891 Ga0209675_10018911 293
109 3300025292 Ga0209676_1000012 Ga0209676_1000012431 293
110 3300025294 Ga0209025_1000306 Ga0209025_100030673 293
111 3300025294 Ga0209025_1000849 Ga0209025_100084935 293
112 3300025294 Ga0209025_1001305 Ga0209025_100130528 293
113 3300025294 Ga0209025_1007105 Ga0209025_10071058 293
114 3300025295 Ga0209564_1001057 Ga0209564_100105728 293
115 3300025295 Ga0209564_1001897 Ga0209564_100189717 293
116 3300025295 Ga0209564_1002568 Ga0209564_100256810 293
117 3300025297 Ga0209758_1006034 Ga0209758_10060344 293
118 3300025299 Ga0209256_1000059 Ga0209256_100005928 293
119 3300025299 Ga0209256_1002918 Ga0209256_10029189 293
120 3300027666 Ga0209282_1000031 Ga0209282_1000031122 293
121 3300046474 Ga0495605_0006676 Ga0495605_0006676_4959_5840 293
122 3300046500 Ga0495596_0000592 Ga0495596_0000592_19884_20765 293
123 3300046501 Ga0495607_0020290 Ga0495607_0020290_2757_3638 293
124 3300046512 Ga0495610_0004840 Ga0495610_0004840_6781_7662 293
125 3300046524 Ga0495648_0050697 Ga0495648_0050697_1281_2162 293
126 3300046538 Ga0495609_0002461 Ga0495609_0002461_2338_3219 293
127 3300046665 Ga0495661_0004338 Ga0495661_0004338_1426_2307 293
128 3300046692 Ga0495671_0000686 Ga0495671_0000686_19950_20831 293
129 3300046694 Ga0495649_0048519 Ga0495649_0048519_1099_1980 293
130 3300047318 Ga0495636_0017936 Ga0495636_0017936_397_1278 293
131 3300047320 Ga0495672_0152671 Ga0495672_0152671_151_1032 293
132 3300048924 Ga0496121_0013668 Ga0496121_0013668_3717_4598 293
133 3300048925 Ga0496122_0001513 Ga0496122_0001513_11308_12189 293
134 3300048926 Ga0496123_0008339 Ga0496123_0008339_256_1137 293
135 3300049571 Ga0501034_0000188 Ga0501034_0000188_75794_76675 293
136 iso_pu_bacteria 644736347 644748515 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03547

Mem_trans

Membrane transport protein

30

172

0.84

PF03547

Mem_trans

Membrane transport protein

168

312

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.8172 3 292
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.8073 3 292
7y9u-assembly1.cif.gz_A structure of the auxin exporter pin1 in arabidopsis thaliana in the npa-bound state 0.7946 2 290
7y9u-assembly1.cif.gz_A structure of the auxin exporter pin1 in arabidopsis thaliana in the npa-bound state 0.7826 2 290
7wks-assembly1.cif.gz_A apo state of atpin3 0.7674 2 290
ID Description Score Start End Superfamily
af_K7LKA4_9_392_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8392 5 287 1.20.1530.20
af_A0A1D8PGN3_16_535_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8249 6 286 1.20.1530.20
af_Q99252_13_602_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8168 6 286 1.20.1530.20
af_K7LKA4_9_392_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8104 5 287 1.20.1530.20
af_K7LDB3_15_430_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8079 5 287 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A5C7UJT2-F1-model_v4 AEC family transporter 0.9907 1 293 GO:0005886
GO:0055085
AF-A0A1G8LYW8-F1-model_v4 Permease 0.9759 2 291 GO:0005886
GO:0055085
AF-A0A1W6K504-F1-model_v4 Membrane transport protein 0.9757 1 291 GO:0005886
GO:0055085
AF-A6GMS0-F1-model_v4 Auxin Efflux Carrier 0.9757 26 291 GO:0005886
GO:0055085
AF-A0A1H2WV30-F1-model_v4 Permease 0.9753 1 291 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map