F165366

General Info

Members Datasets Scaffolds Average Seq Length
136 113 272 187

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10522597|Ga0070658_105225972
Length 209
Sequence MPTCATTWPRRARHAWRGRRDRGERTLRLQATPIPGLWEVETAPRADERGSLTRLYCADALAAAGVDLRIVQVNHSLTRRRGTVRGLHFQRPPALEAKLIRCLRGRVFDVAVDLRLGSPTFARWHAVELAEDNQRQLLIPPGCAHGFQTLADDCELLYHHSAGYAPELEDGVRHNDPCLAIAWPEPIVGVSRRDLGFAAIDDVFVAVPA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
100 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
101 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
102 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
103 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
104 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
106 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
107 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
111 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
112 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
113 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.65
Nodule 0
Rhizoplane 0.74
Rhizosphere 72.06
Stem 0
Stem Tuber 0
Unclassified 19.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10522597 3300005327 Unclassified 1026
2 rootH2_10299871 3300003320 Bacteria 1269
3 rootL2_10363021 3300003322 Bacteria 1850
4 Ga0055524_1006267 3300003775 Bacteria 5180
5 Ga0070670_100008152 3300005331 Bacteria 8920
6 Ga0068869_100584961 3300005334 Bacteria 941
7 Ga0068868_100079806 3300005338 Bacteria 2622
8 Ga0070668_100252958 3300005347 Bacteria 1463
9 Ga0070671_100067737 3300005355 Bacteria 2976
10 Ga0070671_100400585 3300005355 Bacteria 1174
11 Ga0070673_100037545 3300005364 Bacteria 3692
12 Ga0070673_100658929 3300005364 Bacteria 959
13 Ga0070667_100021444 3300005367 Bacteria 5364
14 Ga0070667_100261137 3300005367 Bacteria 1551
15 Ga0070714_101073911 3300005435 Bacteria 784
16 Ga0070713_100220863 3300005436 Unclassified 1719
17 Ga0070694_100443759 3300005444 Bacteria 1023
18 Ga0070678_100197685 3300005456 Bacteria 1657
19 Ga0070685_10613523 3300005466 Unclassified 784
20 Ga0070698_100001841 3300005471 Bacteria 23635
21 Ga0070697_101062117 3300005536 Unclassified 720
22 Ga0070696_100657301 3300005546 Bacteria 850
23 Ga0070665_100136945 3300005548 Bacteria 2452
24 Ga0070665_101382035 3300005548 Unclassified 713
25 Ga0068852_100037664 3300005616 Bacteria 4057
26 Ga0068864_100007896 3300005618 Bacteria 8769
27 Ga0068864_100140360 3300005618 Unclassified 2179
28 Ga0068863_100011171 3300005841 Bacteria 8704
29 Ga0070717_10432081 3300006028 Bacteria 1185
30 Ga0075365_10000706 3300006038 Bacteria 13439
31 Ga0075363_100182021 3300006048 Bacteria 1196
32 Ga0075364_10380903 3300006051 Bacteria 962
33 Ga0070712_100217484 3300006175 Unclassified 1510
34 Ga0075366_10348004 3300006195 Bacteria 909
35 Ga0097621_100796023 3300006237 Bacteria 876
36 Ga0068871_100287159 3300006358 Bacteria 1441
37 Ga0068871_101024140 3300006358 Unclassified 770
38 Ga0068871_101429897 3300006358 Unclassified 652
39 Ga0105245_12240640 3300009098 Bacteria 600
40 Ga0105247_10122654 3300009101 Bacteria 1686
41 Ga0105248_11051605 3300009177 Bacteria 920
42 Ga0105249_10037718 3300009553 Bacteria 4385
43 Ga0157371_10004449 3300013102 Bacteria 12229
44 Ga0157371_10134392 3300013102 Bacteria 1761
45 Ga0157369_10006530 3300013105 Bacteria 13505
46 Ga0157374_10640110 3300013296 Bacteria 1075
47 Ga0157378_10373271 3300013297 Unclassified 1399
48 Ga0157372_10060760 3300013307 Unclassified 4229
49 Ga0157372_10464980 3300013307 Bacteria 1474
50 Ga0157375_10001629 3300013308 Bacteria 19315
51 Ga0163163_10015257 3300014325 Bacteria 7099
52 Ga0157380_10068684 3300014326 Bacteria 2857
53 Ga0182008_10040053 3300014497 Unclassified 2340
54 Ga0157377_10284387 3300014745 Bacteria 1085
55 Ga0157376_10484752 3300014969 Unclassified 1212
56 Ga0182007_10124117 3300015262 Unclassified 865
57 Ga0209565_1006370 3300025263 Bacteria 3318
58 Ga0209675_1012639 3300025291 Bacteria 2704
59 Ga0209050_1007604 3300025298 Bacteria 6021
60 Ga0209256_1000071 3300025299 Bacteria 242618
61 Ga0207680_10008718 3300025903 Bacteria 4994
62 Ga0207693_10240095 3300025915 Unclassified 1422
63 Ga0207681_10011466 3300025923 Bacteria 5448
64 Ga0207700_10277543 3300025928 Bacteria 1440
65 Ga0207644_10254132 3300025931 Bacteria 1403
66 Ga0207644_10284352 3300025931 Bacteria 1329
67 Ga0207644_10677646 3300025931 Bacteria 859
68 Ga0207691_10012411 3300025940 Bacteria 8167
69 Ga0207691_10245320 3300025940 Bacteria 1547
70 Ga0207711_10679530 3300025941 Unclassified 960
71 Ga0207711_10736283 3300025941 Unclassified 919
72 Ga0207689_10631508 3300025942 Bacteria 902
73 Ga0207679_10378701 3300025945 Bacteria 1240
74 Ga0207651_10025312 3300025960 Bacteria 3687
75 Ga0207651_10214144 3300025960 Bacteria 1553
76 Ga0207712_10093085 3300025961 Bacteria 2223
77 Ga0207658_10019351 3300025986 Bacteria 4708
78 Ga0207703_10049423 3300026035 Bacteria 3400
79 Ga0207703_10274138 3300026035 Bacteria 1530
80 Ga0207641_10011064 3300026088 Bacteria 7402
81 Ga0207676_10015566 3300026095 Bacteria 5490
82 Ga0207676_10020690 3300026095 Bacteria 4817
83 Ga0207675_100164675 3300026118 Unclassified 2117
84 Ga0207683_10045015 3300026121 Bacteria 3858
85 Ga0207698_10011152 3300026142 Bacteria 5813
86 Ga0207698_11776323 3300026142 Bacteria 632
87 Ga0268266_10083835 3300028379 Bacteria 2783
88 Ga0268265_10022164 3300028380 Bacteria 4459
89 Ga0268265_11108905 3300028380 Bacteria 786
90 Ga0268264_10014689 3300028381 Bacteria 6435
91 Ga0307517_10001806 3300028786 Bacteria 35156
92 Ga0307515_10283506 3300028794 Unclassified 1361
93 Ga0265327_10000344 3300031251 Bacteria 87965
94 Ga0307513_10135781 3300031456 Bacteria 2396
95 Ga0265313_10050437 3300031595 Bacteria 1997
96 Ga0307508_10001615 3300031616 Bacteria 25170
97 Ga0307516_10001865 3300031730 Bacteria 28896
98 Ga0307406_10294553 3300031901 Bacteria 1244
99 Ga0307406_10504081 3300031901 Bacteria 982
100 Ga0307406_10739120 3300031901 Unclassified 825
101 Ga0307412_10589258 3300031911 Bacteria 940
102 Ga0307416_100696294 3300032002 Bacteria 1105
103 Ga0307411_10430849 3300032005 Bacteria 1098
104 Ga0436364_0674957 3300037853 Unclassified 1649
105 Ga0451577_0016785 3300042876 Bacteria 6770
106 Ga0495627_182300 3300046453 Unclassified 581
107 Ga0495590_0021949 3300046457 Bacteria 2260
108 Ga0495607_0023170 3300046501 Bacteria 3889
109 Ga0495597_0194213 3300046542 Unclassified 815
110 Ga0495649_0001724 3300046694 Bacteria 16164
111 Ga0495600_0164003 3300046809 Bacteria 1435
112 Ga0495660_0046666 3300046810 Bacteria 2375
113 Ga0495660_0151249 3300046810 Bacteria 1146
114 Ga0495687_000615 3300047443 Bacteria 41337
115 Ga0496114_0016932 3300048917 Bacteria 5878
116 Ga0496116_0000026 3300048919 Bacteria 450803
117 Ga0496122_0048982 3300048925 Bacteria 3243
118 Ga0501031_0560145 3300049568 Bacteria 736
119 nmdc:mga0k408_330698_c1 3300050493 Bacteria 909
120 Ga0500578_0006141 3300053086 Bacteria 8075
121 Ga0500644_0000167 3300053088 Bacteria 41835
122 Ga0500646_0061623 3300053090 Unclassified 1105
123 Ga0500569_002143 3300053109 Bacteria 3843
124 Ga0500618_014711 3300053125 Bacteria 1992
125 Ga0500618_016739 3300053125 Bacteria 1830
126 Ga0500655_013834 3300053133 Bacteria 1475
127 Ga0500658_0032384 3300053134 Unclassified 2050
128 Ga0500568_0000351 3300053139 Bacteria 35768
129 Ga0500568_0062401 3300053139 Unclassified 1440
130 Ga0500577_0000353 3300053142 Bacteria 11754
131 Ga0500616_0001605 3300053153 Bacteria 21079
132 Ga0500645_009347 3300053730 Bacteria 3296
133 Ga0500656_032014 3300053732 Unclassified 704
134 2819686267 2818991461 Bacteria 7026071
135 2919168484 2919166419 Bacteria 4952238
136 2978971167 2978969890 Bacteria 5400756
137 Ga0070658_10522597
138 rootH2_10299871
139 rootL2_10363021
140 Ga0055524_1006267
141 Ga0070670_100008152
142 Ga0068869_100584961
143 Ga0068868_100079806
144 Ga0070668_100252958
145 Ga0070671_100067737
146 Ga0070671_100400585
147 Ga0070673_100037545
148 Ga0070673_100658929
149 Ga0070667_100021444
150 Ga0070667_100261137
151 Ga0070714_101073911
152 Ga0070713_100220863
153 Ga0070694_100443759
154 Ga0070678_100197685
155 Ga0070685_10613523
156 Ga0070698_100001841
157 Ga0070697_101062117
158 Ga0070696_100657301
159 Ga0070665_100136945
160 Ga0070665_101382035
161 Ga0068852_100037664
162 Ga0068864_100007896
163 Ga0068864_100140360
164 Ga0068863_100011171
165 Ga0070717_10432081
166 Ga0075365_10000706
167 Ga0075363_100182021
168 Ga0075364_10380903
169 Ga0070712_100217484
170 Ga0075366_10348004
171 Ga0097621_100796023
172 Ga0068871_100287159
173 Ga0068871_101024140
174 Ga0068871_101429897
175 Ga0105245_12240640
176 Ga0105247_10122654
177 Ga0105248_11051605
178 Ga0105249_10037718
179 Ga0157371_10004449
180 Ga0157371_10134392
181 Ga0157369_10006530
182 Ga0157374_10640110
183 Ga0157378_10373271
184 Ga0157372_10060760
185 Ga0157372_10464980
186 Ga0157375_10001629
187 Ga0163163_10015257
188 Ga0157380_10068684
189 Ga0182008_10040053
190 Ga0157377_10284387
191 Ga0157376_10484752
192 Ga0182007_10124117
193 Ga0209565_1006370
194 Ga0209675_1012639
195 Ga0209050_1007604
196 Ga0209256_1000071
197 Ga0207680_10008718
198 Ga0207693_10240095
199 Ga0207681_10011466
200 Ga0207700_10277543
201 Ga0207644_10254132
202 Ga0207644_10284352
203 Ga0207644_10677646
204 Ga0207691_10012411
205 Ga0207691_10245320
206 Ga0207711_10679530
207 Ga0207711_10736283
208 Ga0207689_10631508
209 Ga0207679_10378701
210 Ga0207651_10025312
211 Ga0207651_10214144
212 Ga0207712_10093085
213 Ga0207658_10019351
214 Ga0207703_10049423
215 Ga0207703_10274138
216 Ga0207641_10011064
217 Ga0207676_10015566
218 Ga0207676_10020690
219 Ga0207675_100164675
220 Ga0207683_10045015
221 Ga0207698_10011152
222 Ga0207698_11776323
223 Ga0268266_10083835
224 Ga0268265_10022164
225 Ga0268265_11108905
226 Ga0268264_10014689
227 Ga0307517_10001806
228 Ga0307515_10283506
229 Ga0265327_10000344
230 Ga0307513_10135781
231 Ga0265313_10050437
232 Ga0307508_10001615
233 Ga0307516_10001865
234 Ga0307406_10294553
235 Ga0307406_10504081
236 Ga0307406_10739120
237 Ga0307412_10589258
238 Ga0307416_100696294
239 Ga0307411_10430849
240 Ga0436364_0674957
241 Ga0451577_0016785
242 Ga0495627_182300
243 Ga0495590_0021949
244 Ga0495607_0023170
245 Ga0495597_0194213
246 Ga0495649_0001724
247 Ga0495600_0164003
248 Ga0495660_0046666
249 Ga0495660_0151249
250 Ga0495687_000615
251 Ga0496114_0016932
252 Ga0496116_0000026
253 Ga0496122_0048982
254 Ga0501031_0560145
255 nmdc:mga0k408_330698_c1
256 Ga0500578_0006141
257 Ga0500644_0000167
258 Ga0500646_0061623
259 Ga0500569_002143
260 Ga0500618_014711
261 Ga0500618_016739
262 Ga0500655_013834
263 Ga0500658_0032384
264 Ga0500568_0000351
265 Ga0500568_0062401
266 Ga0500577_0000353
267 Ga0500616_0001605
268 Ga0500645_009347
269 Ga0500656_032014
270 2819686267
271 2919168484
272 2978971167

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

31

202

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9744 2 174
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9675 2 173
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9642 2 173
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9619 2 174
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9606 1 173
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9619 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9552 1 173 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9519 1 173 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.951 2 173 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9506 2 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1G6ZEU6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9982 1 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A5B8V454-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9964 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4Q3W6K4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.9958 1 171 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2M7N2T1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9955 1 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2D5TFY5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.994 48 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map