F161221

General Info

Members Datasets Scaffolds Average Seq Length
134 64 268 275

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0003748|Ga0501033_0003748_2572_3477
Length 301
Sequence MLNVPLGSNRFSKWSGLVPPAAAKVPAMARIPLEDNYTDVLRKAQRGRKIPDRELLAQSGVSAAELAAVRGGEPSDAVLRRLARHLRLGPNALGTLAAKGWYPEQPVFPRGFLMFNSPFEDMTVNSYLIWDTKTKLAAAFDTGSTCEPMLNEIQSAGLSLRYIFLTHTHRDHIADLPRLAKATGAEVWASEREPSDHPGAKTFKENAHFHLGEIAIKTLLTWGHSPGLTTFFVTGLSWPLAVVGDSIFASSMGGSATHFIDQYQNNYSKILTLPRDTVLACGHGPLTTLAQEKKHNPFFAP

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
12 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
13 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
14 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
15 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
20 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
21 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
22 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
23 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
24 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
25 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
26 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
27 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
28 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
29 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
30 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
31 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
32 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
51 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
60 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
63 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
64 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 0
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0003748 3300049570 Bacteria 12356
2 rootL2_10050054 3300003322 Bacteria 2376
3 rootH1_10076314 3300003323 Bacteria 2552
4 rootH1_10101701 3300003323 Bacteria 4221
5 Ga0070683_100005816 3300005329 Bacteria 10317
6 Ga0068869_100000077 3300005334 Bacteria 44272
7 Ga0070668_100049040 3300005347 Bacteria 3249
8 Ga0070684_100138213 3300005535 Bacteria 2202
9 Ga0068863_100340773 3300005841 Bacteria 1458
10 Ga0081455_10063529 3300005937 Unclassified 3098
11 Ga0081538_10065508 3300005981 Unclassified 2045
12 Ga0097621_100007938 3300006237 Bacteria 7616
13 Ga0068865_100002945 3300006881 Bacteria 10153
14 Ga0105237_10425477 3300009545 Unclassified 1333
15 Ga0163163_10427744 3300014325 Bacteria 1383
16 Ga0207642_10080741 3300025899 Bacteria 1578
17 Ga0207700_10323639 3300025928 Unclassified 1337
18 Ga0207689_10000023 3300025942 Bacteria 107806
19 Ga0207648_10009161 3300026089 Bacteria 9511
20 Ga0265337_1034690 3300028556 Unclassified 1482
21 Ga0265337_1056334 3300028556 Unclassified 1096
22 Ga0265319_1000026 3300028563 Bacteria 141358
23 Ga0265319_1000660 3300028563 Bacteria 22674
24 Ga0265319_1002638 3300028563 Bacteria 9648
25 Ga0265319_1005577 3300028563 Bacteria 5998
26 Ga0265319_1010323 3300028563 Bacteria 3903
27 Ga0265319_1011323 3300028563 Bacteria 3658
28 Ga0265319_1038712 3300028563 Bacteria 1620
29 Ga0265334_10001530 3300028573 Bacteria 11176
30 Ga0265318_10005483 3300028577 Bacteria 5954
31 Ga0265318_10007787 3300028577 Bacteria 4815
32 Ga0265318_10008071 3300028577 Bacteria 4709
33 Ga0265318_10010871 3300028577 Bacteria 3946
34 Ga0265323_10005607 3300028653 Bacteria 5325
35 Ga0265323_10007082 3300028653 Bacteria 4683
36 Ga0265323_10014690 3300028653 Bacteria 3091
37 Ga0265323_10060598 3300028653 Unclassified 1317
38 Ga0265322_10019230 3300028654 Bacteria 1961
39 Ga0265338_10000329 3300028800 Bacteria 86337
40 Ga0265338_10004641 3300028800 Bacteria 18467
41 Ga0265338_10015269 3300028800 Bacteria 8454
42 Ga0265324_10006030 3300029957 Bacteria 5125
43 Ga0265324_10030115 3300029957 Bacteria 1906
44 Ga0265330_10008349 3300031235 Bacteria 4987
45 Ga0265320_10000735 3300031240 Bacteria 25059
46 Ga0265320_10001071 3300031240 Bacteria 20251
47 Ga0265320_10019409 3300031240 Bacteria 3717
48 Ga0265320_10022057 3300031240 Bacteria 3414
49 Ga0265320_10023464 3300031240 Bacteria 3284
50 Ga0265320_10036860 3300031240 Bacteria 2468
51 Ga0265320_10051176 3300031240 Bacteria 2005
52 Ga0265325_10004497 3300031241 Bacteria 8792
53 Ga0265331_10060724 3300031250 Bacteria 1785
54 Ga0265327_10000016 3300031251 Bacteria 467439
55 Ga0265327_10003013 3300031251 Bacteria 16704
56 Ga0265327_10007862 3300031251 Bacteria 8105
57 Ga0265327_10008591 3300031251 Bacteria 7574
58 Ga0265316_10030647 3300031344 Bacteria 4406
59 Ga0265316_10041087 3300031344 Bacteria 3704
60 Ga0265316_10067784 3300031344 Bacteria 2759
61 Ga0265316_10146319 3300031344 Archaea 1772
62 Ga0265316_10327797 3300031344 Bacteria 1111
63 Ga0307509_10238273 3300031507 Bacteria 1615
64 Ga0307408_100000032 3300031548 Bacteria 213693
65 Ga0265313_10000228 3300031595 Bacteria 60668
66 Ga0265313_10001658 3300031595 Bacteria 20635
67 Ga0265313_10002081 3300031595 Bacteria 17894
68 Ga0265313_10004089 3300031595 Bacteria 11365
69 Ga0265313_10021190 3300031595 Bacteria 3560
70 Ga0265313_10091809 3300031595 Bacteria 1362
71 Ga0307508_10000022 3300031616 Bacteria 180417
72 Ga0265314_10003515 3300031711 Bacteria 15121
73 Ga0265314_10196846 3300031711 Bacteria 1194
74 Ga0265342_10004395 3300031712 Bacteria 11124
75 Ga0265342_10022881 3300031712 Bacteria 3965
76 Ga0265342_10029896 3300031712 Bacteria 3380
77 Ga0265342_10050490 3300031712 Bacteria 2485
78 Ga0265342_10062377 3300031712 Unclassified 2194
79 Ga0265342_10086363 3300031712 Bacteria 1804
80 Ga0265342_10101188 3300031712 Bacteria 1641
81 Ga0265342_10101724 3300031712 Bacteria 1636
82 Ga0307410_10000015 3300031852 Bacteria 73395
83 Ga0307407_10051331 3300031903 Bacteria 2363
84 Ga0307409_100000111 3300031995 Bacteria 30018
85 Ga0307416_100000038 3300032002 Bacteria 136704
86 Ga0395905_0000036 3300037471 Bacteria 271733
87 Ga0451577_0000012 3300042876 Bacteria 575467
88 Ga0453683_0000226 3300044673 Bacteria 75571
89 Ga0453683_0020729 3300044673 Bacteria 4200
90 Ga0453683_0025315 3300044673 Bacteria 3772
91 Ga0453684_0024445 3300044712 Bacteria 8829
92 Ga0453684_0101568 3300044712 Bacteria 3518
93 Ga0466959_0043369 3300045049 Unclassified 3316
94 Ga0451576_0000206 3300045051 Bacteria 147691
95 Ga0451576_0002869 3300045051 Bacteria 24688
96 Ga0451576_0018151 3300045051 Bacteria 7718
97 Ga0451576_0034112 3300045051 Bacteria 5406
98 Ga0451576_0051203 3300045051 Bacteria 4329
99 Ga0451576_0133831 3300045051 Bacteria 2584
100 Ga0501031_0031344 3300049568 Bacteria 3468
101 Ga0501032_0010353 3300049569 Bacteria 6722
102 Ga0501032_0012602 3300049569 Bacteria 6036
103 Ga0501032_0048601 3300049569 Bacteria 2864
104 Ga0501033_0043226 3300049570 Bacteria 3356
105 Ga0501034_0059527 3300049571 Bacteria 3836
106 Ga0501036_0002679 3300049572 Bacteria 14045
107 Ga0501037_0067441 3300049573 Bacteria 2605
108 Ga0501038_0024973 3300049574 Bacteria 5328
109 Ga0501038_0141982 3300049574 Bacteria 1964
110 Ga0501038_0320257 3300049574 Unclassified 1213
111 Ga0501038_0389364 3300049574 Bacteria 1080
112 Ga0501039_0009120 3300049575 Bacteria 7560
113 Ga0501043_0116192 3300049579 Bacteria 2100
114 Ga0501043_0168009 3300049579 Unclassified 1712
115 Ga0501046_0002232 3300049580 Bacteria 18276
116 Ga0501046_0091474 3300049580 Unclassified 2340
117 Ga0501046_0143701 3300049580 Bacteria 1803
118 Ga0501047_0017488 3300049581 Bacteria 6867
119 Ga0501047_0031737 3300049581 Bacteria 5095
120 Ga0501047_0189824 3300049581 Bacteria 1918
121 Ga0501070_0130530 3300049586 Unclassified 2076
122 Ga0501070_0152728 3300049586 Bacteria 1904
123 Ga0501083_0007519 3300049744 Bacteria 7720
124 Ga0501083_0024152 3300049744 Bacteria 4214
125 Ga0501083_0054585 3300049744 Bacteria 2681
126 Ga0501035_0023447 3300049822 Bacteria 5660
127 Ga0501035_0041804 3300049822 Bacteria 4137
128 Ga0501035_0079991 3300049822 Bacteria 2886
129 Ga0501035_0403750 3300049822 Bacteria 1136
130 Ga0501044_0000599 3300049823 Bacteria 43688
131 Ga0501044_0064819 3300049823 Bacteria 3727
132 Ga0501044_0069282 3300049823 Bacteria 3591
133 nmdc:mga0k408_132231_c1 3300050493 Bacteria 1481
134 Ga0500555_000015 3300053103 Bacteria 230204
135 Ga0501033_0003748
136 rootL2_10050054
137 rootH1_10076314
138 rootH1_10101701
139 Ga0070683_100005816
140 Ga0068869_100000077
141 Ga0070668_100049040
142 Ga0070684_100138213
143 Ga0068863_100340773
144 Ga0081455_10063529
145 Ga0081538_10065508
146 Ga0097621_100007938
147 Ga0068865_100002945
148 Ga0105237_10425477
149 Ga0163163_10427744
150 Ga0207642_10080741
151 Ga0207700_10323639
152 Ga0207689_10000023
153 Ga0207648_10009161
154 Ga0265337_1034690
155 Ga0265337_1056334
156 Ga0265319_1000026
157 Ga0265319_1000660
158 Ga0265319_1002638
159 Ga0265319_1005577
160 Ga0265319_1010323
161 Ga0265319_1011323
162 Ga0265319_1038712
163 Ga0265334_10001530
164 Ga0265318_10005483
165 Ga0265318_10007787
166 Ga0265318_10008071
167 Ga0265318_10010871
168 Ga0265323_10005607
169 Ga0265323_10007082
170 Ga0265323_10014690
171 Ga0265323_10060598
172 Ga0265322_10019230
173 Ga0265338_10000329
174 Ga0265338_10004641
175 Ga0265338_10015269
176 Ga0265324_10006030
177 Ga0265324_10030115
178 Ga0265330_10008349
179 Ga0265320_10000735
180 Ga0265320_10001071
181 Ga0265320_10019409
182 Ga0265320_10022057
183 Ga0265320_10023464
184 Ga0265320_10036860
185 Ga0265320_10051176
186 Ga0265325_10004497
187 Ga0265331_10060724
188 Ga0265327_10000016
189 Ga0265327_10003013
190 Ga0265327_10007862
191 Ga0265327_10008591
192 Ga0265316_10030647
193 Ga0265316_10041087
194 Ga0265316_10067784
195 Ga0265316_10146319
196 Ga0265316_10327797
197 Ga0307509_10238273
198 Ga0307408_100000032
199 Ga0265313_10000228
200 Ga0265313_10001658
201 Ga0265313_10002081
202 Ga0265313_10004089
203 Ga0265313_10021190
204 Ga0265313_10091809
205 Ga0307508_10000022
206 Ga0265314_10003515
207 Ga0265314_10196846
208 Ga0265342_10004395
209 Ga0265342_10022881
210 Ga0265342_10029896
211 Ga0265342_10050490
212 Ga0265342_10062377
213 Ga0265342_10086363
214 Ga0265342_10101188
215 Ga0265342_10101724
216 Ga0307410_10000015
217 Ga0307407_10051331
218 Ga0307409_100000111
219 Ga0307416_100000038
220 Ga0395905_0000036
221 Ga0451577_0000012
222 Ga0453683_0000226
223 Ga0453683_0020729
224 Ga0453683_0025315
225 Ga0453684_0024445
226 Ga0453684_0101568
227 Ga0466959_0043369
228 Ga0451576_0000206
229 Ga0451576_0002869
230 Ga0451576_0018151
231 Ga0451576_0034112
232 Ga0451576_0051203
233 Ga0451576_0133831
234 Ga0501031_0031344
235 Ga0501032_0010353
236 Ga0501032_0012602
237 Ga0501032_0048601
238 Ga0501033_0043226
239 Ga0501034_0059527
240 Ga0501036_0002679
241 Ga0501037_0067441
242 Ga0501038_0024973
243 Ga0501038_0141982
244 Ga0501038_0320257
245 Ga0501038_0389364
246 Ga0501039_0009120
247 Ga0501043_0116192
248 Ga0501043_0168009
249 Ga0501046_0002232
250 Ga0501046_0091474
251 Ga0501046_0143701
252 Ga0501047_0017488
253 Ga0501047_0031737
254 Ga0501047_0189824
255 Ga0501070_0130530
256 Ga0501070_0152728
257 Ga0501083_0007519
258 Ga0501083_0024152
259 Ga0501083_0054585
260 Ga0501035_0023447
261 Ga0501035_0041804
262 Ga0501035_0079991
263 Ga0501035_0403750
264 Ga0501044_0000599
265 Ga0501044_0064819
266 Ga0501044_0069282
267 nmdc:mga0k408_132231_c1
268 Ga0500555_000015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

120

283

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ve5-assembly2.cif.gz_B crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.8809 85 269
2cro-assembly1.cif.gz_A structure of phage 434 cro protein at 2.35 angstroms resolution 0.8805 9 67
5ve4-assembly2.cif.gz_B crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.8794 85 269
3fym-assembly1.cif.gz_A the 1a structure of ymfm, a putative dna-binding membrane protein from staphylococcus aureus 0.8736 8 73
1r69-assembly1.cif.gz_A structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution 0.8732 10 67
ID Description Score Start End Superfamily
af_Q6PII5_1_211_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8895 83 255 3.60.15.10
af_P9WMW3_3_221_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8834 88 273 3.60.15.10
af_O06154_65_262_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8797 86 273 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.879 86 271 3.60.15.10
3fymA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8736 8 73 1.10.260.40
ID Description Score Start End GO Terms
AF-W0J3X3-F1-model_v4 Beta-lactamase 0.9963 3 273 GO:0016787
AF-B4D0D6-F1-model_v4 Beta-lactamase domain protein 0.9811 3 272 GO:0016787
AF-A0A5R8KIW3-F1-model_v4 MBL fold metallo-hydrolase 0.9793 4 272 GO:0016787
AF-A0A2U8E628-F1-model_v4 MBL fold metallo-hydrolase 0.979 1 273 GO:0016787
AF-A0A3E1E386-F1-model_v4 Beta-lactamase superfamily II 0.9777 3 272 GO:0016787

Map