F161149

General Info

Members Datasets Scaffolds Average Seq Length
134 104 123 222

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0000367|Ga0496117_0000367_49289_50011
Length 240
Sequence MASSSAVRAALFDIDGTLIDSNYLHIDAWTRAFADVGAPVDAWRVHRAIGLDSGKLLDTLLGDRVDELGERTKHRHSAYYEELSPRLRRFDGARELIQALSGSGVRVVLATSAPPEEFEVLRACLDVDDLLYAATTADDVETAKPDPDIIGVALRRADVSAGDAVMIGDTRWDAEAAGRAGVRSLGVLSGGIGAGALLDAGAAEVFDDVAAMLTAVTDDGPQRLSGRSVDRNPRDEEQPR

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
3 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
4 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
5 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
6 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
7 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
8 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
9 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
10 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
59 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
98 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
99 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
100 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.04
Metatranscriptomes 0.75
Isolates 8.21

Biome Distribution

Category Percentage (%)
Aerial Root 1.49
Bulb 0
Endosphere 21.64
Nodule 0
Rhizoplane 5.97
Rhizosphere 55.97
Stem 0
Stem Tuber 0
Unclassified 14.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000774 3300002067 Bacteria 11375
2 rootH1_10041815 3300003323 Bacteria 3254
3 Ga0055527_1000004 3300003760 Bacteria 570634
4 Ga0055542_1000019 3300003762 Bacteria 341174
5 Ga0055529_1000008 3300003763 Bacteria 394786
6 Ga0070658_10197984 3300005327 Bacteria 1694
7 Ga0070690_100721798 3300005330 Bacteria 767
8 Ga0070692_10097022 3300005345 Bacteria 1611
9 Ga0070675_100361989 3300005354 Bacteria 1288
10 Ga0070714_100023209 3300005435 Bacteria 5092
11 Ga0070714_100180777 3300005435 Bacteria 1919
12 Ga0070714_100897678 3300005435 Bacteria 860
13 Ga0070710_10106235 3300005437 Bacteria 1680
14 Ga0070679_100044961 3300005530 Bacteria 4400
15 Ga0070679_100258247 3300005530 Bacteria 1698
16 Ga0068857_100078694 3300005577 Bacteria 2943
17 Ga0068862_101075850 3300005844 Bacteria 798
18 Ga0070717_10153495 3300006028 Unclassified 1994
19 Ga0075363_100000281 3300006048 Bacteria 14744
20 Ga0075363_100009620 3300006048 Bacteria 4551
21 Ga0075363_100016438 3300006048 Bacteria 3654
22 Ga0075363_100137656 3300006048 Bacteria 1373
23 Ga0075364_10016355 3300006051 Bacteria 4614
24 Ga0075364_10088398 3300006051 Bacteria 2054
25 Ga0075364_10168813 3300006051 Bacteria 1478
26 Ga0070712_100011643 3300006175 Bacteria 5586
27 Ga0075370_10068881 3300006353 Bacteria 2021
28 Ga0105240_10022726 3300009093 Bacteria 8308
29 Ga0105237_10386937 3300009545 Bacteria 1403
30 Ga0105238_11096502 3300009551 Bacteria 819
31 Ga0105239_10019218 3300010375 Bacteria 7547
32 Ga0157369_10227556 3300013105 Bacteria 1951
33 Ga0157369_10429511 3300013105 Bacteria 1369
34 Ga0157374_10053635 3300013296 Bacteria 3759
35 Ga0157372_10027996 3300013307 Bacteria 6145
36 Ga0157372_10231579 3300013307 Bacteria 2142
37 Ga0157372_10590697 3300013307 Unclassified 1294
38 Ga0163163_10493928 3300014325 Bacteria 1285
39 Ga0206353_10859946 3300020082 Bacteria 786
40 Ga0213876_10228862 3300021384 Bacteria 988
41 Ga0213875_10002316 3300021388 Bacteria 11526
42 Ga0209672_100011 3300025228 Bacteria 856297
43 Ga0209147_100808 3300025229 Bacteria 15044
44 Ga0209258_103057 3300025242 Bacteria 3835
45 Ga0209148_1000023 3300025254 Bacteria 680511
46 Ga0209455_1000023 3300025272 Bacteria 680449
47 Ga0207695_10029906 3300025913 Bacteria 6008
48 Ga0207671_10242957 3300025914 Bacteria 1414
49 Ga0207693_10008788 3300025915 Bacteria 8257
50 Ga0207664_10212349 3300025929 Bacteria 1675
51 Ga0207661_10012067 3300025944 Bacteria 6278
52 Ga0207702_10295509 3300026078 Bacteria 1536
53 Ga0207674_10138609 3300026116 Bacteria 2393
54 Ga0268265_11073135 3300028380 Bacteria 798
55 Ga0307411_10232866 3300032005 Bacteria 1437
56 Ga0436364_1110548 3300037853 Bacteria 23022
57 Ga0436365_0132547 3300039437 Bacteria 1779
58 Ga0436365_0348165 3300039437 Bacteria 4047
59 Ga0436363_0126030 3300039450 Bacteria 838
60 Ga0451791_0315106 3300041451 Bacteria 1133
61 Ga0451841_1282075 3300041498 Bacteria 778
62 Ga0451853_3695423 3300041512 Bacteria 1575
63 Ga0466972_0012139 3300044658 Bacteria 4328
64 Ga0466972_0038449 3300044658 Bacteria 2337
65 Ga0466966_0029723 3300044684 Bacteria 3553
66 Ga0466966_0035392 3300044684 Bacteria 3226
67 Ga0466961_0026738 3300044693 Bacteria 3710
68 Ga0466964_0189652 3300044706 Bacteria 980
69 Ga0466971_0055635 3300044719 Bacteria 1784
70 Ga0466968_0061612 3300044735 Bacteria 1619
71 Ga0466968_0148771 3300044735 Bacteria 1075
72 Ga0466970_0009768 3300044765 Bacteria 4858
73 Ga0466970_0122050 3300044765 Bacteria 1428
74 Ga0466970_0136285 3300044765 Bacteria 1350
75 Ga0466957_0024789 3300044842 Bacteria 3552
76 Ga0466957_0187334 3300044842 Bacteria 1354
77 Ga0466960_0032777 3300044901 Bacteria 2409
78 Ga0466960_0145632 3300044901 Bacteria 1261
79 Ga0466958_0103831 3300045836 Bacteria 1770
80 Ga0466967_0385658 3300045976 Bacteria 1361
81 Ga0466967_0563877 3300045976 Bacteria 1122
82 Ga0495665_0099169 3300046531 Bacteria 1529
83 Ga0495588_0136638 3300046674 Bacteria 1294
84 Ga0495670_0481521 3300046691 Bacteria 673
85 Ga0495581_0051743 3300047315 Bacteria 2372
86 Ga0495672_0062868 3300047320 Bacteria 2133
87 Ga0496100_0343224 3300048903 Bacteria 1126
88 Ga0496102_0472314 3300048905 Bacteria 1175
89 Ga0496112_0019783 3300048915 Bacteria 6366
90 Ga0496114_0352921 3300048917 Unclassified 1301
91 Ga0496115_0001972 3300048918 Bacteria 14642
92 Ga0496115_0619585 3300048918 Bacteria 858
93 Ga0496115_0784236 3300048918 Bacteria 743
94 Ga0496117_0000367 3300048920 Bacteria 78467
95 Ga0496117_0268332 3300048920 Bacteria 921
96 Ga0496122_0003917 3300048925 Bacteria 19044
97 Ga0496123_0193781 3300048926 Bacteria 1049
98 Ga0496125_0033537 3300048928 Bacteria 4541
99 Ga0496126_0097363 3300048929 Bacteria 2578
100 Ga0496126_0441834 3300048929 Bacteria 1048
101 Ga0501033_0586626 3300049570 Bacteria 765
102 Ga0501034_0735192 3300049571 Bacteria 883
103 Ga0501043_0009944 3300049579 Bacteria 7459
104 Ga0501047_0007468 3300049581 Bacteria 10289
105 Ga0501070_0000046 3300049586 Bacteria 107844
106 Ga0501070_0158308 3300049586 Bacteria 1868
107 Ga0501035_0012471 3300049822 Bacteria 7854
108 Ga0501044_0020761 3300049823 Bacteria 7009
109 nmdc:mga03n38_58900_c1 3300050490 Bacteria 1741
110 nmdc:mga03n38_6753_c1 3300050490 Bacteria 4013
111 nmdc:mga00v17_14701_c1 3300050491 Bacteria 4377
112 nmdc:mga00v17_197258_c1 3300050491 Bacteria 1301
113 nmdc:mga06z11_84769_c1 3300050494 Bacteria 1155
114 nmdc:mga07m45_227_c3 3300050496 Bacteria 17015
115 nmdc:mga0sz30_21508_c1 3300050516 Bacteria 2023
116 nmdc:mga0sz30_296559_c1 3300050516 Bacteria 721
117 Ga0500635_0000016 3300053080 Bacteria 124879
118 Ga0500573_0021436 3300053140 Bacteria 3703
119 Ga0500573_0189108 3300053140 Bacteria 1101
120 Ga0500616_0000126 3300053153 Bacteria 134967
121 Ga0500645_000039 3300053730 Bacteria 111509
122 Ga0466962_0023157 3300061719 Bacteria 2986
123 Ga0466962_0061812 3300061719 Bacteria 1788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10022726 Ga0105240_100227261 198
2 3300009545 Ga0105237_10386937 Ga0105237_103869372 198
3 3300009551 Ga0105238_11096502 Ga0105238_110965021 198
4 3300010375 Ga0105239_10019218 Ga0105239_100192182 198
5 3300025913 Ga0207695_10029906 Ga0207695_100299067 198
6 3300025914 Ga0207671_10242957 Ga0207671_102429572 198
7 3300045836 Ga0466958_0103831 Ga0466958_0103831_202_873 200
8 3300005435 Ga0070714_100023209 Ga0070714_1000232095 201
9 3300005437 Ga0070710_10106235 Ga0070710_101062351 201
10 3300006028 Ga0070717_10153495 Ga0070717_101534953 201
11 3300006175 Ga0070712_100011643 Ga0070712_1000116435 201
12 3300025915 Ga0207693_10008788 Ga0207693_100087884 201
13 3300048905 Ga0496102_0472314 Ga0496102_0472314_271_999 201
14 3300048917 Ga0496114_0352921 Ga0496114_0352921_331_1059 201
15 3300048918 Ga0496115_0001972 Ga0496115_0001972_1605_2333 201
16 3300047320 Ga0495672_0062868 Ga0495672_0062868_790_1485 204
17 3300048918 Ga0496115_0784236 Ga0496115_0784236_83_733 204
18 3300045976 Ga0466967_0385658 Ga0466967_0385658_496_1221 209
19 3300046691 Ga0495670_0481521 Ga0495670_0481521_11_649 209
20 3300053153 Ga0500616_0000126 Ga0500616_0000126_3162_3800 209
21 3300005327 Ga0070658_10197984 Ga0070658_101979842 210
22 3300005330 Ga0070690_100721798 Ga0070690_1007217981 210
23 3300005345 Ga0070692_10097022 Ga0070692_100970221 210
24 3300005354 Ga0070675_100361989 Ga0070675_1003619891 210
25 3300005530 Ga0070679_100044961 Ga0070679_1000449613 210
26 3300005530 Ga0070679_100258247 Ga0070679_1002582472 210
27 3300005577 Ga0068857_100078694 Ga0068857_1000786944 210
28 3300013307 Ga0157372_10027996 Ga0157372_100279967 210
29 3300014325 Ga0163163_10493928 Ga0163163_104939282 210
30 3300025944 Ga0207661_10012067 Ga0207661_100120677 210
31 3300026078 Ga0207702_10295509 Ga0207702_102955092 210
32 3300026116 Ga0207674_10138609 Ga0207674_101386093 210
33 3300048915 Ga0496112_0019783 Ga0496112_0019783_3577_4224 210
34 3300048918 Ga0496115_0619585 Ga0496115_0619585_83_718 211
35 3300049571 Ga0501034_0735192 Ga0501034_0735192_87_731 214
36 3300049579 Ga0501043_0009944 Ga0501043_0009944_1191_1835 214
37 3300049581 Ga0501047_0007468 Ga0501047_0007468_2280_2924 214
38 3300049586 Ga0501070_0158308 Ga0501070_0158308_200_844 214
39 3300049822 Ga0501035_0012471 Ga0501035_0012471_5410_6054 214
40 3300049823 Ga0501044_0020761 Ga0501044_0020761_1029_1673 214
41 3300032005 Ga0307411_10232866 Ga0307411_102328662 215
42 3300041451 Ga0451791_0315106 Ga0451791_0315106_150_827 215
43 3300003760 Ga0055527_1000004 Ga0055527_1000004423 216
44 3300003762 Ga0055542_1000019 Ga0055542_1000019211 216
45 3300003763 Ga0055529_1000008 Ga0055529_1000008154 216
46 3300013105 Ga0157369_10227556 Ga0157369_102275563 216
47 3300025228 Ga0209672_100011 Ga0209672_100011422 216
48 3300025229 Ga0209147_100808 Ga0209147_1008087 216
49 3300025242 Ga0209258_103057 Ga0209258_1030576 216
50 3300025254 Ga0209148_1000023 Ga0209148_1000023260 216
51 3300025272 Ga0209455_1000023 Ga0209455_1000023260 216
52 3300044658 Ga0466972_0012139 Ga0466972_0012139_22_729 216
53 3300044735 Ga0466968_0061612 Ga0466968_0061612_82_789 216
54 3300044901 Ga0466960_0032777 Ga0466960_0032777_523_1230 216
55 3300045976 Ga0466967_0563877 Ga0466967_0563877_362_1069 216
56 3300048903 Ga0496100_0343224 Ga0496100_0343224_373_1023 216
57 3300048929 Ga0496126_0441834 Ga0496126_0441834_299_949 216
58 3300049570 Ga0501033_0586626 Ga0501033_0586626_56_706 216
59 3300049586 Ga0501070_0000046 Ga0501070_0000046_53289_53939 216
60 3300050491 nmdc:mga00v17_197258_c1 nmdc:mga00v17_197258_c1_519_1184 216
61 3300050516 nmdc:mga0sz30_296559_c1 nmdc:mga0sz30_296559_c1_28_693 216
62 3300053080 Ga0500635_0000016 Ga0500635_0000016_8851_9501 216
63 3300061719 Ga0466962_0061812 Ga0466962_0061812_1065_1772 216
64 3300005435 Ga0070714_100897678 Ga0070714_1008976781 217
65 3300006048 Ga0075363_100000281 Ga0075363_1000002813 217
66 3300013296 Ga0157374_10053635 Ga0157374_100536353 217
67 iso_pu_bacteria 2974315732 2974319548 217
68 iso_pu_bacteria 2984523437 2984527755 217
69 3300053140 Ga0500573_0189108 Ga0500573_0189108_23_688 218
70 iso_pu_bacteria 2565956761 2566994917 218
71 iso_pu_bacteria 2904535858 2904535934 218
72 3300005435 Ga0070714_100180777 Ga0070714_1001807771 219
73 3300025929 Ga0207664_10212349 Ga0207664_102123491 219
74 3300044684 Ga0466966_0035392 Ga0466966_0035392_2338_3003 219
75 3300044719 Ga0466971_0055635 Ga0466971_0055635_174_839 219
76 3300044765 Ga0466970_0122050 Ga0466970_0122050_190_855 219
77 3300044842 Ga0466957_0187334 Ga0466957_0187334_249_914 219
78 3300044706 Ga0466964_0189652 Ga0466964_0189652_178_861 220
79 3300044765 Ga0466970_0009768 Ga0466970_0009768_314_997 220
80 3300044901 Ga0466960_0145632 Ga0466960_0145632_475_1158 220
81 3300061719 Ga0466962_0023157 Ga0466962_0023157_351_1034 220
82 iso_pu_bacteria 2904430863 2904433830 220
83 3300003323 rootH1_10041815 rootH1_100418151 221
84 3300021388 Ga0213875_10002316 Ga0213875_1000231610 221
85 3300037853 Ga0436364_1110548 Ga0436364_1110548_15110_15790 221
86 3300039437 Ga0436365_0348165 Ga0436365_0348165_1406_2086 221
87 3300039450 Ga0436363_0126030 Ga0436363_0126030_84_764 221
88 3300044765 Ga0466970_0136285 Ga0466970_0136285_520_1200 221
89 iso_pu_bacteria 2811994872 2812323454 221
90 iso_pu_bacteria 2984551494 2984552583 221
91 3300002067 JGI24735J21928_10000774 JGI24735J21928_100007748 222
92 3300005844 Ga0068862_101075850 Ga0068862_1010758501 222
93 3300006048 Ga0075363_100009620 Ga0075363_1000096206 222
94 3300006048 Ga0075363_100016438 Ga0075363_1000164383 222
95 3300006048 Ga0075363_100137656 Ga0075363_1001376562 222
96 3300006051 Ga0075364_10016355 Ga0075364_100163552 222
97 3300006051 Ga0075364_10088398 Ga0075364_100883983 222
98 3300006051 Ga0075364_10168813 Ga0075364_101688132 222
99 3300006353 Ga0075370_10068881 Ga0075370_100688812 222
100 3300013105 Ga0157369_10429511 Ga0157369_104295112 222
101 3300013307 Ga0157372_10231579 Ga0157372_102315792 222
102 3300013307 Ga0157372_10590697 Ga0157372_105906971 222
103 3300020082 Ga0206353_10859946 Ga0206353_108599461 222
104 3300021384 Ga0213876_10228862 Ga0213876_102288621 222
105 3300028380 Ga0268265_11073135 Ga0268265_110731351 222
106 3300039437 Ga0436365_0132547 Ga0436365_0132547_1002_1691 222
107 3300041498 Ga0451841_1282075 Ga0451841_1282075_10_723 222
108 3300041512 Ga0451853_3695423 Ga0451853_3695423_718_1404 222
109 3300044658 Ga0466972_0038449 Ga0466972_0038449_99_767 222
110 3300044684 Ga0466966_0029723 Ga0466966_0029723_2086_2754 222
111 3300044693 Ga0466961_0026738 Ga0466961_0026738_1291_1959 222
112 3300044735 Ga0466968_0148771 Ga0466968_0148771_210_878 222
113 3300044842 Ga0466957_0024789 Ga0466957_0024789_854_1522 222
114 3300046531 Ga0495665_0099169 Ga0495665_0099169_389_1078 222
115 3300046674 Ga0495588_0136638 Ga0495588_0136638_542_1231 222
116 3300047315 Ga0495581_0051743 Ga0495581_0051743_1063_1752 222
117 3300048920 Ga0496117_0000367 Ga0496117_0000367_49289_50011 222
118 3300048920 Ga0496117_0268332 Ga0496117_0268332_102_815 222
119 3300048925 Ga0496122_0003917 Ga0496122_0003917_13136_13822 222
120 3300048926 Ga0496123_0193781 Ga0496123_0193781_66_752 222
121 3300048928 Ga0496125_0033537 Ga0496125_0033537_3251_3937 222
122 3300048929 Ga0496126_0097363 Ga0496126_0097363_1672_2352 222
123 3300050490 nmdc:mga03n38_58900_c1 nmdc:mga03n38_58900_c1_928_1629 222
124 3300050490 nmdc:mga03n38_6753_c1 nmdc:mga03n38_6753_c1_631_1335 222
125 3300050491 nmdc:mga00v17_14701_c1 nmdc:mga00v17_14701_c1_3420_4121 222
126 3300050494 nmdc:mga06z11_84769_c1 nmdc:mga06z11_84769_c1_116_820 222
127 3300050496 nmdc:mga07m45_227_c3 nmdc:mga07m45_227_c3_88_792 222
128 3300050516 nmdc:mga0sz30_21508_c1 nmdc:mga0sz30_21508_c1_53_733 222
129 3300053140 Ga0500573_0021436 Ga0500573_0021436_1408_2088 222
130 3300053730 Ga0500645_000039 Ga0500645_000039_45511_46191 222
131 iso_pu_bacteria 2857729791 2857731278 222
132 iso_pu_bacteria 2928121344 2928122175 222
133 iso_pu_bacteria 2939657138 2939657661 222
134 iso_pu_bacteria 8057345674 8057347237 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

7

181

0.94

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

10

187

0.93

PF13242

Hydrolase_like

HAD-hyrolase-like

141

212

0.92

PF12710

HAD

haloacid dehalogenase-like hydrolase

10

178

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.9644 4 215
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9638 4 215
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9636 4 215
3s6j-assembly3.cif.gz_C the crystal structure of a hydrolase from pseudomonas syringae 0.9557 5 215
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.9541 4 215
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.941 86 182 3.40.50.1000
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.938 4 215 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9351 85 212 3.40.50.1000
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9325 93 207 3.40.50.1000
af_Q84MD8_87_222_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9189 79 207 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3D9R528-F1-model_v4 deleted 0.9856 2 205
AF-X0Q3E5-F1-model_v4 Putative hydrolase 0.9853 1 186 GO:0005829
GO:0006281
GO:0008967
AF-A0A3N6H338-F1-model_v4 deleted 0.985 4 213
AF-A0A124I0W5-F1-model_v4 HAD family hydrolase 0.9831 4 213 GO:0005829
GO:0006281
GO:0008967
AF-A0A7L5B016-F1-model_v4 deleted 0.9828 2 213

Feature Viewer

pLDDT pTM Quality
94.63 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map