F160286

General Info

Members Datasets Scaffolds Average Seq Length
134 99 268 147

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10040280|Ga0265338_100402804
Length 150
Sequence MKSKVLFVCIHNSARSQMAEAFLNQICGEEFEGYSAGLEPGTLNPNVVTVMKESAIDISGNKTKSVSEMINSELAFSYVITVCDETSAERCPIFPGGATTRLHWSFADPSSFRGSHAEVLVKTREVREAIKQRIEQWCAEVCRKRVGKSD

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 2.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 4.48
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 13.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10040280 3300028800 Bacteria 4392
2 Ga0065712_10189411 3300005290 Bacteria 1155
3 Ga0065715_10002111 3300005293 Bacteria 6157
4 Ga0070689_100003494 3300005340 Bacteria 10456
5 Ga0070689_100099361 3300005340 Bacteria 2302
6 Ga0070675_100627346 3300005354 Bacteria 976
7 Ga0070713_100117087 3300005436 Bacteria 2331
8 Ga0070708_100217187 3300005445 Bacteria 1792
9 Ga0070706_100023572 3300005467 Bacteria 5666
10 Ga0070707_100000049 3300005468 Bacteria 102972
11 Ga0070707_100028100 3300005468 Bacteria 5351
12 Ga0070707_100102678 3300005468 Bacteria 2771
13 Ga0070707_100157301 3300005468 Bacteria 2214
14 Ga0070698_100122133 3300005471 Bacteria 2564
15 Ga0070698_100446635 3300005471 Bacteria 1229
16 Ga0070697_100006593 3300005536 Bacteria 8999
17 Ga0068855_101028783 3300005563 Bacteria 864
18 Ga0070702_100593525 3300005615 Unclassified 829
19 Ga0068859_100316368 3300005617 Bacteria 1655
20 Ga0081539_10003178 3300005985 Bacteria 20815
21 Ga0075362_10412327 3300006177 Unclassified 682
22 Ga0097621_100126835 3300006237 Bacteria 2168
23 Ga0097621_100497049 3300006237 Unclassified 1104
24 Ga0068871_100863487 3300006358 Bacteria 837
25 Ga0075429_101368866 3300006880 Bacteria 617
26 Ga0097620_100316366 3300006931 Bacteria 1655
27 Ga0075435_100761713 3300007076 Bacteria 842
28 Ga0105240_10006497 3300009093 Bacteria 17174
29 Ga0105240_10321198 3300009093 Bacteria 1765
30 Ga0105240_11875965 3300009093 Bacteria 624
31 Ga0111539_10071199 3300009094 Bacteria 4103
32 Ga0111539_10197755 3300009094 Bacteria 2345
33 Ga0111539_10778783 3300009094 Bacteria 1113
34 Ga0105245_10166181 3300009098 Bacteria 2098
35 Ga0114129_11134617 3300009147 Bacteria 977
36 Ga0105248_11306349 3300009177 Bacteria 820
37 Ga0105238_11150046 3300009551 Bacteria 800
38 Ga0105239_10194443 3300010375 Bacteria 2271
39 Ga0157378_10935869 3300013297 Bacteria 899
40 Ga0163162_10165272 3300013306 Bacteria 2336
41 Ga0157372_10949353 3300013307 Unclassified 997
42 Ga0157372_11875012 3300013307 Bacteria 689
43 Ga0157372_12198381 3300013307 Bacteria 634
44 Ga0157376_12751831 3300014969 Bacteria 532
45 Ga0207695_10412270 3300025913 Bacteria 1235
46 Ga0207646_10000761 3300025922 Bacteria 41842
47 Ga0207646_10242817 3300025922 Bacteria 1627
48 Ga0207694_10961465 3300025924 Unclassified 722
49 Ga0207700_10317443 3300025928 Bacteria 1349
50 Ga0207664_10378946 3300025929 Bacteria 1256
51 Ga0207670_10004434 3300025936 Bacteria 7561
52 Ga0207665_10604761 3300025939 Bacteria 856
53 Ga0207667_10555050 3300025949 Unclassified 1161
54 Ga0207641_10276904 3300026088 Bacteria 1576
55 Ga0207676_10166556 3300026095 Bacteria 1916
56 Ga0265319_1000027 3300028563 Bacteria 139786
57 Ga0265319_1081359 3300028563 Bacteria 1028
58 Ga0265334_10071744 3300028573 Bacteria 1289
59 Ga0265323_10286584 3300028653 Bacteria 510
60 Ga0265322_10069476 3300028654 Unclassified 999
61 Ga0265338_10000069 3300028800 Bacteria 186219
62 Ga0265338_10028357 3300028800 Bacteria 5586
63 Ga0265338_10091582 3300028800 Bacteria 2511
64 Ga0265338_10162250 3300028800 Bacteria 1725
65 Ga0265324_10155772 3300029957 Unclassified 776
66 Ga0265762_1003471 3300030760 Bacteria 2825
67 Ga0265770_1016484 3300030878 Bacteria 1132
68 Ga0265760_10117771 3300031090 Unclassified 851
69 Ga0265332_10003370 3300031238 Bacteria 7740
70 Ga0265332_10201590 3300031238 Bacteria 827
71 Ga0265320_10005032 3300031240 Bacteria 8561
72 Ga0265320_10050457 3300031240 Bacteria 2022
73 Ga0265325_10000085 3300031241 Bacteria 64937
74 Ga0265325_10082637 3300031241 Bacteria 1594
75 Ga0265325_10235607 3300031241 Unclassified 833
76 Ga0265339_10018315 3300031249 Bacteria 4129
77 Ga0265339_10247107 3300031249 Unclassified 865
78 Ga0265331_10078718 3300031250 Unclassified 1534
79 Ga0265316_10495164 3300031344 Unclassified 873
80 Ga0265313_10000015 3300031595 Bacteria 154649
81 Ga0265313_10007485 3300031595 Bacteria 7449
82 Ga0265313_10090677 3300031595 Bacteria 1373
83 Ga0265342_10008176 3300031712 Bacteria 7545
84 Ga0265342_10027399 3300031712 Unclassified 3562
85 Ga0373936_0421377 3300035113 Bacteria 615
86 Ga0373953_0169301 3300035117 Bacteria 940
87 Ga0373954_0048538 3300035118 Bacteria 1989
88 Ga0373933_0720143 3300035724 Bacteria 656
89 Ga0373947_0180534 3300035725 Bacteria 1374
90 Ga0373925_1366585 3300037068 Bacteria 581
91 Ga0400487_64718 3300039110 Bacteria 15044
92 Ga0451577_0000347 3300042876 Bacteria 86343
93 Ga0451577_0412759 3300042876 Bacteria 1225
94 Ga0451577_0476905 3300042876 Bacteria 1132
95 Ga0453683_0249355 3300044673 Bacteria 1131
96 Ga0453684_0011133 3300044712 Bacteria 15173
97 Ga0453684_0089269 3300044712 Bacteria 3813
98 Ga0453684_0177654 3300044712 Bacteria 2502
99 Ga0495592_0487842 3300046454 Bacteria 766
100 Ga0495651_0120937 3300046462 Bacteria 1924
101 Ga0495653_0151499 3300046463 Bacteria 1620
102 Ga0495582_0740032 3300046473 Bacteria 569
103 Ga0495664_0645518 3300046477 Bacteria 627
104 Ga0495594_0347204 3300046499 Bacteria 845
105 Ga0495608_0340182 3300046511 Bacteria 925
106 Ga0495630_0121119 3300046517 Bacteria 1985
107 Ga0495630_0189673 3300046517 Bacteria 1568
108 Ga0495587_0307028 3300046536 Bacteria 887
109 Ga0495634_0014441 3300046642 Bacteria 5694
110 Ga0495599_0008029 3300046678 Bacteria 6407
111 Ga0495669_0183331 3300046684 Bacteria 998
112 Ga0495613_0208879 3300046689 Bacteria 1374
113 Ga0495624_0044548 3300046690 Bacteria 2828
114 Ga0495674_0070177 3300047319 Bacteria 3028
115 Ga0495680_0599628 3300047322 Bacteria 737
116 Ga0495675_0361388 3300047444 Bacteria 852
117 Ga0495684_0250169 3300047471 Bacteria 1290
118 Ga0496100_0189341 3300048903 Unclassified 1493
119 Ga0496100_0648467 3300048903 Bacteria 822
120 Ga0496103_0620506 3300048906 Bacteria 688
121 Ga0496105_0094132 3300048908 Unclassified 2474
122 Ga0496106_0988999 3300048909 Bacteria 662
123 Ga0496115_0013912 3300048918 Bacteria 6089
124 Ga0501080_0030927 3300049742 Bacteria 4989
125 nmdc:mga03683_368692_c1 3300050489 Unclassified 682
126 nmdc:mga06r32_719822_c1 3300050510 Bacteria 963
127 nmdc:mga08y16_701481_c1 3300050511 Bacteria 1012
128 nmdc:mga08y16_85759_c1 3300050511 Bacteria 3282
129 nmdc:mga0n895_454719_c1 3300050512 Bacteria 1292
130 nmdc:mga0rr50_1364980_c1 3300050513 Bacteria 600
131 nmdc:mga0rr50_731840_c1 3300050513 Bacteria 844
132 Ga0495601_0703530 3300053077 Bacteria 645
133 Ga0500650_0121545 3300053098 Unclassified 1217
134 Ga0500650_0268776 3300053098 Bacteria 761
135 Ga0265338_10040280
136 Ga0065712_10189411
137 Ga0065715_10002111
138 Ga0070689_100003494
139 Ga0070689_100099361
140 Ga0070675_100627346
141 Ga0070713_100117087
142 Ga0070708_100217187
143 Ga0070706_100023572
144 Ga0070707_100000049
145 Ga0070707_100028100
146 Ga0070707_100102678
147 Ga0070707_100157301
148 Ga0070698_100122133
149 Ga0070698_100446635
150 Ga0070697_100006593
151 Ga0068855_101028783
152 Ga0070702_100593525
153 Ga0068859_100316368
154 Ga0081539_10003178
155 Ga0075362_10412327
156 Ga0097621_100126835
157 Ga0097621_100497049
158 Ga0068871_100863487
159 Ga0075429_101368866
160 Ga0097620_100316366
161 Ga0075435_100761713
162 Ga0105240_10006497
163 Ga0105240_10321198
164 Ga0105240_11875965
165 Ga0111539_10071199
166 Ga0111539_10197755
167 Ga0111539_10778783
168 Ga0105245_10166181
169 Ga0114129_11134617
170 Ga0105248_11306349
171 Ga0105238_11150046
172 Ga0105239_10194443
173 Ga0157378_10935869
174 Ga0163162_10165272
175 Ga0157372_10949353
176 Ga0157372_11875012
177 Ga0157372_12198381
178 Ga0157376_12751831
179 Ga0207695_10412270
180 Ga0207646_10000761
181 Ga0207646_10242817
182 Ga0207694_10961465
183 Ga0207700_10317443
184 Ga0207664_10378946
185 Ga0207670_10004434
186 Ga0207665_10604761
187 Ga0207667_10555050
188 Ga0207641_10276904
189 Ga0207676_10166556
190 Ga0265319_1000027
191 Ga0265319_1081359
192 Ga0265334_10071744
193 Ga0265323_10286584
194 Ga0265322_10069476
195 Ga0265338_10000069
196 Ga0265338_10028357
197 Ga0265338_10091582
198 Ga0265338_10162250
199 Ga0265324_10155772
200 Ga0265762_1003471
201 Ga0265770_1016484
202 Ga0265760_10117771
203 Ga0265332_10003370
204 Ga0265332_10201590
205 Ga0265320_10005032
206 Ga0265320_10050457
207 Ga0265325_10000085
208 Ga0265325_10082637
209 Ga0265325_10235607
210 Ga0265339_10018315
211 Ga0265339_10247107
212 Ga0265331_10078718
213 Ga0265316_10495164
214 Ga0265313_10000015
215 Ga0265313_10007485
216 Ga0265313_10090677
217 Ga0265342_10008176
218 Ga0265342_10027399
219 Ga0373936_0421377
220 Ga0373953_0169301
221 Ga0373954_0048538
222 Ga0373933_0720143
223 Ga0373947_0180534
224 Ga0373925_1366585
225 Ga0400487_64718
226 Ga0451577_0000347
227 Ga0451577_0412759
228 Ga0451577_0476905
229 Ga0453683_0249355
230 Ga0453684_0011133
231 Ga0453684_0089269
232 Ga0453684_0177654
233 Ga0495592_0487842
234 Ga0495651_0120937
235 Ga0495653_0151499
236 Ga0495582_0740032
237 Ga0495664_0645518
238 Ga0495594_0347204
239 Ga0495608_0340182
240 Ga0495630_0121119
241 Ga0495630_0189673
242 Ga0495587_0307028
243 Ga0495634_0014441
244 Ga0495599_0008029
245 Ga0495669_0183331
246 Ga0495613_0208879
247 Ga0495624_0044548
248 Ga0495674_0070177
249 Ga0495680_0599628
250 Ga0495675_0361388
251 Ga0495684_0250169
252 Ga0496100_0189341
253 Ga0496100_0648467
254 Ga0496103_0620506
255 Ga0496105_0094132
256 Ga0496106_0988999
257 Ga0496115_0013912
258 Ga0501080_0030927
259 nmdc:mga03683_368692_c1
260 nmdc:mga06r32_719822_c1
261 nmdc:mga08y16_701481_c1
262 nmdc:mga08y16_85759_c1
263 nmdc:mga0n895_454719_c1
264 nmdc:mga0rr50_1364980_c1
265 nmdc:mga0rr50_731840_c1
266 Ga0495601_0703530
267 Ga0500650_0121545
268 Ga0500650_0268776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

5

138

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9593 3 140
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9454 3 138
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9378 3 140
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9253 3 138
1jl3-assembly4.cif.gz_D crystal structure of b. subtilis arsc 0.9177 3 138
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9016 2 138 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8963 3 138 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8884 5 138 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8769 2 138 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8685 3 138 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6DHW6-F1-model_v4 Arsenate reductase ArsC 0.9921 1 83 GO:0046685
AF-A0A2V6DHW6-F1-model_v4 Arsenate reductase ArsC 0.9804 1 83 GO:0046685
AF-W5VJV6-F1-model_v4 Protein tyrosine phosphatase 0.972 3 144 GO:0046685
AF-A0A444J064-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9716 2 140 GO:0004726
GO:0016491
GO:0030946
GO:0046685
GO:0140793
AF-A0A1Z9ETB3-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9711 2 142 GO:0046685

Map