F159866

General Info

Members Datasets Scaffolds Average Seq Length
134 110 134 246

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10744596|Ga0157375_107445961
Length 250
Sequence LGPRSTTQHLAGLVRSSISVVALTGAGISVPSGIPDFRSPGTGLWENVDPMEVAHIDAFRRDPARFWSFYRPRFGMLSDKAPNGAHEALAELERRDLLDGVITQNIDRLHARAGSRRVVEVHGSIETGSCFDCGATFQLEDVVERMVAADGVARCSGCAGPVKPDVVLFGEMLPEAAMEEAYQLAAGADLMLCVGSSLEVYPVAGLPAVTRRAGGRIAIVTKGPTPYDSEATLKLDGDVVDELGAVLAAL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
67 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
104 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
109 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
110 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 15.67
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001818 3300000546 Bacteria 2818
2 JGI24746J21847_1000029 3300001977 Bacteria 13404
3 JGI24034J26672_10000184 3300002239 Bacteria 8469
4 JGI24742J22300_10001263 3300002244 Bacteria 3963
5 Ga0070683_100016990 3300005329 Bacteria 6422
6 Ga0070691_10000055 3300005341 Bacteria 31550
7 Ga0070700_100028580 3300005441 Bacteria 3319
8 Ga0070662_100000001 3300005457 Bacteria 317995
9 Ga0070681_10015709 3300005458 Bacteria 7545
10 Ga0068853_100004929 3300005539 Bacteria 10393
11 Ga0070665_100000022 3300005548 Bacteria 379286
12 Ga0068864_100000024 3300005618 Bacteria 252632
13 Ga0068866_10005604 3300005718 Bacteria 5195
14 Ga0068861_100087003 3300005719 Bacteria 2458
15 Ga0068863_100003875 3300005841 Bacteria 14797
16 Ga0068858_100000140 3300005842 Bacteria 76446
17 Ga0075433_10007302 3300006852 Bacteria 8765
18 Ga0075434_100005958 3300006871 Bacteria 11157
19 Ga0075436_100208488 3300006914 Bacteria 1385
20 Ga0105245_10000022 3300009098 Bacteria 181225
21 Ga0114129_10001888 3300009147 Bacteria 28579
22 Ga0105242_10003474 3300009176 Bacteria 12252
23 Ga0105242_10639089 3300009176 Bacteria 1033
24 Ga0105249_10000054 3300009553 Bacteria 162883
25 Ga0105239_10423401 3300010375 Unclassified 1509
26 Ga0157374_10002903 3300013296 Bacteria 14364
27 Ga0157375_10001744 3300013308 Bacteria 18673
28 Ga0157375_10077995 3300013308 Bacteria 3344
29 Ga0157375_10735710 3300013308 Bacteria 1138
30 Ga0157375_10744596 3300013308 Bacteria 1132
31 Ga0163163_11006788 3300014325 Bacteria 897
32 Ga0157380_10001224 3300014326 Bacteria 16643
33 Ga0157379_10015441 3300014968 Bacteria 6701
34 Ga0163161_10514295 3300017792 Bacteria 977
35 Ga0207642_10003092 3300025899 Bacteria 5216
36 Ga0207707_10015298 3300025912 Bacteria 6680
37 Ga0207652_10000536 3300025921 Bacteria 38532
38 Ga0207687_10000065 3300025927 Bacteria 80752
39 Ga0207706_10000003 3300025933 Bacteria 345011
40 Ga0207686_10000035 3300025934 Bacteria 130483
41 Ga0207686_10180414 3300025934 Bacteria 1497
42 Ga0207661_10011488 3300025944 Bacteria 6419
43 Ga0207679_10021801 3300025945 Bacteria 4351
44 Ga0207712_10000032 3300025961 Bacteria 210628
45 Ga0207640_10061112 3300025981 Bacteria 2494
46 Ga0207703_10000020 3300026035 Bacteria 251603
47 Ga0207639_10003588 3300026041 Bacteria 10420
48 Ga0207708_10044068 3300026075 Bacteria 3400
49 Ga0207641_10005602 3300026088 Bacteria 10701
50 Ga0207676_10000048 3300026095 Bacteria 147853
51 Ga0207675_100079087 3300026118 Bacteria 3081
52 Ga0268266_10000029 3300028379 Bacteria 424015
53 Ga0268266_10635806 3300028379 Bacteria 1026
54 Ga0265337_1002089 3300028556 Bacteria 9441
55 Ga0265322_10000017 3300028654 Bacteria 114833
56 Ga0265331_10000505 3300031250 Bacteria 36592
57 Ga0265316_10037178 3300031344 Bacteria 3932
58 Ga0265342_10145236 3300031712 Bacteria 1321
59 Ga0451833_1041440 3300041491 Bacteria 1858
60 Ga0451853_3905886 3300041512 Bacteria 3947
61 Ga0466963_0000051 3300044694 Bacteria 39254
62 Ga0495592_0000733 3300046454 Bacteria 22899
63 Ga0495592_0042455 3300046454 Bacteria 3406
64 Ga0495603_0002795 3300046455 Bacteria 10302
65 Ga0495629_0025638 3300046459 Bacteria 4190
66 Ga0495629_0042056 3300046459 Bacteria 3212
67 Ga0495641_0000010 3300046461 Bacteria 158798
68 Ga0495651_0052124 3300046462 Bacteria 3152
69 Ga0495662_0173586 3300046476 Bacteria 1062
70 Ga0495620_0000154 3300046515 Bacteria 55875
71 Ga0495630_0000125 3300046517 Bacteria 61325
72 Ga0495630_0079781 3300046517 Bacteria 2469
73 Ga0495630_0164855 3300046517 Bacteria 1687
74 Ga0495652_0028422 3300046529 Bacteria 4921
75 Ga0495587_0001679 3300046536 Bacteria 14777
76 Ga0495621_0008030 3300046539 Bacteria 3147
77 Ga0495645_0039690 3300046543 Bacteria 3433
78 Ga0495645_0088434 3300046543 Bacteria 2216
79 Ga0495633_0027516 3300046558 Bacteria 2780
80 Ga0495656_0000446 3300046615 Bacteria 13498
81 Ga0495634_0001282 3300046642 Bacteria 23024
82 Ga0495625_0000552 3300046660 Bacteria 54805
83 Ga0495657_0023302 3300046675 Bacteria 4425
84 Ga0495657_0052480 3300046675 Bacteria 2733
85 Ga0495599_0070799 3300046678 Bacteria 2177
86 Ga0495647_0000002 3300046681 Bacteria 174959
87 Ga0495669_0000067 3300046684 Bacteria 68406
88 Ga0495669_0041281 3300046684 Bacteria 2048
89 Ga0495670_0093152 3300046691 Bacteria 1544
90 Ga0495649_0053086 3300046694 Bacteria 2195
91 Ga0495676_0193746 3300047321 Bacteria 1416
92 Ga0495680_0002462 3300047322 Bacteria 18949
93 Ga0495602_0151180 3300048088 Bacteria 1825
94 Ga0496100_0000006 3300048903 Bacteria 297429
95 Ga0496101_0000005 3300048904 Bacteria 331455
96 Ga0496101_0000009 3300048904 Bacteria 297429
97 Ga0496102_0000021 3300048905 Bacteria 246920
98 Ga0496103_0000001 3300048906 Bacteria 643471
99 Ga0496104_0000008 3300048907 Bacteria 516976
100 Ga0496105_0000003 3300048908 Bacteria 713251
101 Ga0496106_0000033 3300048909 Bacteria 131412
102 Ga0496106_0000072 3300048909 Bacteria 80978
103 Ga0496107_0000004 3300048910 Bacteria 297680
104 Ga0496107_0000015 3300048910 Bacteria 173644
105 Ga0496108_0000004 3300048911 Bacteria 545055
106 Ga0496108_0027280 3300048911 Bacteria 4714
107 Ga0496108_0086642 3300048911 Bacteria 2659
108 Ga0496109_0000031 3300048912 Bacteria 163998
109 Ga0496109_0000369 3300048912 Bacteria 41635
110 Ga0496111_0517397 3300048914 Unclassified 878
111 Ga0496113_0353533 3300048916 Bacteria 1179
112 Ga0496113_0382230 3300048916 Unclassified 1130
113 Ga0496114_0000003 3300048917 Bacteria 630981
114 Ga0496115_0000027 3300048918 Bacteria 145505
115 Ga0501038_0239027 3300049574 Bacteria 1443
116 Ga0501042_0041798 3300049578 Bacteria 3261
117 Ga0501068_0323782 3300049584 Bacteria 988
118 nmdc:mga05p37_975_c1 3300050507 Bacteria 32492
119 nmdc:mga0n895_1644_c1 3300050512 Bacteria 16904
120 nmdc:mga0rr50_175188_c1 3300050513 Bacteria 1750
121 nmdc:mga0a205_6762_c1 3300050515 Bacteria 10370
122 nmdc:mga0a205_9195_c1 3300050515 Bacteria 9020
123 Ga0495601_0000231 3300053077 Bacteria 30020
124 Ga0495601_0023953 3300053077 Bacteria 3755
125 Ga0495601_0027013 3300053077 Bacteria 3547
126 Ga0495612_0046190 3300053078 Bacteria 1783
127 Ga0495655_0000008 3300053083 Bacteria 153535
128 Ga0495595_0059979 3300053084 Bacteria 1780
129 Ga0495619_0000001 3300053085 Bacteria 586054
130 Ga0495619_0101455 3300053085 Bacteria 1959
131 Ga0500566_0006056 3300053094 Bacteria 7187
132 Ga0500641_0008697 3300053096 Bacteria 3631
133 Ga0500614_000060 3300053123 Bacteria 23367
134 Ga0500628_000023 3300053129 Bacteria 77818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100016990 Ga0070683_1000169904 221
2 3300005618 Ga0068864_100000024 Ga0068864_100000024180 221
3 3300005718 Ga0068866_10005604 Ga0068866_100056043 221
4 3300025899 Ga0207642_10003092 Ga0207642_100030924 221
5 3300026095 Ga0207676_10000048 Ga0207676_1000004874 221
6 3300046691 Ga0495670_0093152 Ga0495670_0093152_861_1526 221
7 3300025945 Ga0207679_10021801 Ga0207679_100218013 222
8 3300046454 Ga0495592_0042455 Ga0495592_0042455_1220_1984 222
9 3300048916 Ga0496113_0353533 Ga0496113_0353533_190_954 222
10 3300049584 Ga0501068_0323782 Ga0501068_0323782_74_766 222
11 3300014325 Ga0163163_11006788 Ga0163163_110067881 224
12 3300048088 Ga0495602_0151180 Ga0495602_0151180_883_1629 224
13 3300046476 Ga0495662_0173586 Ga0495662_0173586_57_821 226
14 3300046684 Ga0495669_0041281 Ga0495669_0041281_109_873 226
15 3300005457 Ga0070662_100000001 Ga0070662_100000001261 228
16 3300025933 Ga0207706_10000003 Ga0207706_1000000370 228
17 3300005441 Ga0070700_100028580 Ga0070700_1000285802 229
18 3300005458 Ga0070681_10015709 Ga0070681_100157097 229
19 3300025912 Ga0207707_10015298 Ga0207707_100152985 229
20 3300025921 Ga0207652_10000536 Ga0207652_1000053611 229
21 3300026075 Ga0207708_10044068 Ga0207708_100440682 229
22 3300046454 Ga0495592_0000733 Ga0495592_0000733_109_801 230
23 3300046459 Ga0495629_0042056 Ga0495629_0042056_1393_2085 230
24 3300046675 Ga0495657_0023302 Ga0495657_0023302_3626_4318 230
25 3300047321 Ga0495676_0193746 Ga0495676_0193746_189_881 230
26 3300048911 Ga0496108_0027280 Ga0496108_0027280_1068_1760 230
27 3300048912 Ga0496109_0000369 Ga0496109_0000369_22973_23665 230
28 3300046539 Ga0495621_0008030 Ga0495621_0008030_2385_3119 232
29 3300048907 Ga0496104_0000008 Ga0496104_0000008_334040_334798 234
30 3300048908 Ga0496105_0000003 Ga0496105_0000003_334040_334798 234
31 3300046681 Ga0495647_0000002 Ga0495647_0000002_153330_154046 238
32 3300053085 Ga0495619_0000001 Ga0495619_0000001_222881_223597 238
33 3300046642 Ga0495634_0001282 Ga0495634_0001282_14169_14894 241
34 3300053084 Ga0495595_0059979 Ga0495595_0059979_1028_1753 241
35 3300005719 Ga0068861_100087003 Ga0068861_1000870033 243
36 3300026118 Ga0207675_100079087 Ga0207675_1000790873 243
37 3300005841 Ga0068863_100003875 Ga0068863_1000038752 244
38 3300006914 Ga0075436_100208488 Ga0075436_1002084882 244
39 3300009553 Ga0105249_10000054 Ga0105249_1000005477 244
40 3300014326 Ga0157380_10001224 Ga0157380_100012242 244
41 3300025961 Ga0207712_10000032 Ga0207712_1000003288 244
42 3300026088 Ga0207641_10005602 Ga0207641_1000560211 244
43 3300048903 Ga0496100_0000006 Ga0496100_0000006_142870_143604 244
44 3300048904 Ga0496101_0000009 Ga0496101_0000009_142870_143604 244
45 3300048905 Ga0496102_0000021 Ga0496102_0000021_27135_27869 244
46 3300048906 Ga0496103_0000001 Ga0496103_0000001_568038_568772 244
47 3300048909 Ga0496106_0000072 Ga0496106_0000072_57926_58660 244
48 3300048910 Ga0496107_0000015 Ga0496107_0000015_39098_39832 244
49 3300048911 Ga0496108_0000004 Ga0496108_0000004_238716_239453 244
50 3300048912 Ga0496109_0000031 Ga0496109_0000031_84929_85666 244
51 3300053083 Ga0495655_0000008 Ga0495655_0000008_113189_113926 244
52 3300053096 Ga0500641_0008697 Ga0500641_0008697_2186_2923 244
53 3300053129 Ga0500628_000023 Ga0500628_000023_68103_68840 244
54 3300025927 Ga0207687_10000065 Ga0207687_1000006562 245
55 3300046462 Ga0495651_0052124 Ga0495651_0052124_1992_2744 246
56 3300047322 Ga0495680_0002462 Ga0495680_0002462_11936_12688 246
57 3300006852 Ga0075433_10007302 Ga0075433_100073025 247
58 3300006871 Ga0075434_100005958 Ga0075434_1000059587 247
59 3300009147 Ga0114129_10001888 Ga0114129_1000188815 247
60 3300013308 Ga0157375_10744596 Ga0157375_107445961 247
61 3300046615 Ga0495656_0000446 Ga0495656_0000446_11588_12331 247
62 3300048914 Ga0496111_0517397 Ga0496111_0517397_81_830 247
63 3300048916 Ga0496113_0382230 Ga0496113_0382230_314_1063 247
64 3300050507 nmdc:mga05p37_975_c1 nmdc:mga05p37_975_c1_15064_15816 247
65 3300050512 nmdc:mga0n895_1644_c1 nmdc:mga0n895_1644_c1_10096_10848 247
66 3300050515 nmdc:mga0a205_6762_c1 nmdc:mga0a205_6762_c1_3556_4308 247
67 3300001977 JGI24746J21847_1000029 JGI24746J21847_10000297 248
68 3300046660 Ga0495625_0000552 Ga0495625_0000552_22844_23593 248
69 3300009176 Ga0105242_10003474 Ga0105242_100034749 249
70 3300025934 Ga0207686_10000035 Ga0207686_1000003545 249
71 3300028556 Ga0265337_1002089 Ga0265337_10020894 249
72 3300028654 Ga0265322_10000017 Ga0265322_1000001747 249
73 3300031250 Ga0265331_10000505 Ga0265331_1000050533 249
74 3300031344 Ga0265316_10037178 Ga0265316_100371783 249
75 3300031712 Ga0265342_10145236 Ga0265342_101452362 249
76 3300046455 Ga0495603_0002795 Ga0495603_0002795_4528_5340 249
77 3300053078 Ga0495612_0046190 Ga0495612_0046190_267_1031 249
78 3300000546 LJNas_1001818 LJNas_10018183 250
79 3300002239 JGI24034J26672_10000184 JGI24034J26672_100001842 250
80 3300002244 JGI24742J22300_10001263 JGI24742J22300_100012634 250
81 3300005341 Ga0070691_10000055 Ga0070691_100000556 250
82 3300005539 Ga0068853_100004929 Ga0068853_1000049298 250
83 3300005548 Ga0070665_100000022 Ga0070665_100000022214 250
84 3300005842 Ga0068858_100000140 Ga0068858_10000014082 250
85 3300009098 Ga0105245_10000022 Ga0105245_1000002216 250
86 3300009176 Ga0105242_10639089 Ga0105242_106390892 250
87 3300010375 Ga0105239_10423401 Ga0105239_104234013 250
88 3300013296 Ga0157374_10002903 Ga0157374_1000290312 250
89 3300013308 Ga0157375_10001744 Ga0157375_1000174416 250
90 3300013308 Ga0157375_10077995 Ga0157375_100779952 250
91 3300013308 Ga0157375_10735710 Ga0157375_107357102 250
92 3300014968 Ga0157379_10015441 Ga0157379_100154413 250
93 3300017792 Ga0163161_10514295 Ga0163161_105142951 250
94 3300025934 Ga0207686_10180414 Ga0207686_101804142 250
95 3300025944 Ga0207661_10011488 Ga0207661_100114884 250
96 3300025981 Ga0207640_10061112 Ga0207640_100611123 250
97 3300026035 Ga0207703_10000020 Ga0207703_10000020266 250
98 3300026041 Ga0207639_10003588 Ga0207639_100035888 250
99 3300028379 Ga0268266_10000029 Ga0268266_10000029239 250
100 3300028379 Ga0268266_10635806 Ga0268266_106358062 250
101 3300041491 Ga0451833_1041440 Ga0451833_1041440_924_1688 250
102 3300041512 Ga0451853_3905886 Ga0451853_3905886_513_1277 250
103 3300044694 Ga0466963_0000051 Ga0466963_0000051_11050_11823 250
104 3300046459 Ga0495629_0025638 Ga0495629_0025638_1977_2729 250
105 3300046461 Ga0495641_0000010 Ga0495641_0000010_142386_143150 250
106 3300046515 Ga0495620_0000154 Ga0495620_0000154_21192_21956 250
107 3300046517 Ga0495630_0000125 Ga0495630_0000125_23863_24633 250
108 3300046517 Ga0495630_0079781 Ga0495630_0079781_490_1257 250
109 3300046517 Ga0495630_0164855 Ga0495630_0164855_148_912 250
110 3300046529 Ga0495652_0028422 Ga0495652_0028422_463_1227 250
111 3300046536 Ga0495587_0001679 Ga0495587_0001679_3013_3777 250
112 3300046543 Ga0495645_0039690 Ga0495645_0039690_1371_2135 250
113 3300046543 Ga0495645_0088434 Ga0495645_0088434_69_833 250
114 3300046558 Ga0495633_0027516 Ga0495633_0027516_720_1484 250
115 3300046675 Ga0495657_0052480 Ga0495657_0052480_1072_1842 250
116 3300046678 Ga0495599_0070799 Ga0495599_0070799_1316_2080 250
117 3300046684 Ga0495669_0000067 Ga0495669_0000067_29582_30346 250
118 3300046694 Ga0495649_0053086 Ga0495649_0053086_858_1622 250
119 3300048904 Ga0496101_0000005 Ga0496101_0000005_95303_96088 250
120 3300048909 Ga0496106_0000033 Ga0496106_0000033_45292_46077 250
121 3300048910 Ga0496107_0000004 Ga0496107_0000004_95520_96305 250
122 3300048911 Ga0496108_0086642 Ga0496108_0086642_1762_2526 250
123 3300048917 Ga0496114_0000003 Ga0496114_0000003_293527_294279 250
124 3300048918 Ga0496115_0000027 Ga0496115_0000027_19813_20565 250
125 3300049574 Ga0501038_0239027 Ga0501038_0239027_614_1384 250
126 3300049578 Ga0501042_0041798 Ga0501042_0041798_1768_2532 250
127 3300050513 nmdc:mga0rr50_175188_c1 nmdc:mga0rr50_175188_c1_417_1181 250
128 3300050515 nmdc:mga0a205_9195_c1 nmdc:mga0a205_9195_c1_1965_2735 250
129 3300053077 Ga0495601_0000231 Ga0495601_0000231_28061_28825 250
130 3300053077 Ga0495601_0023953 Ga0495601_0023953_2460_3227 250
131 3300053077 Ga0495601_0027013 Ga0495601_0027013_294_1064 250
132 3300053085 Ga0495619_0101455 Ga0495619_0101455_1056_1826 250
133 3300053094 Ga0500566_0006056 Ga0500566_0006056_1538_2290 250
134 3300053123 Ga0500614_000060 Ga0500614_000060_3393_4157 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

25

202

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d4b-assembly1.cif.gz_A crystal structure of sir2tm in complex with acetyl p53 peptide and dadme-nad+ 0.9575 7 247
2h2g-assembly1.cif.gz_A the structural basis of sirtuin substrate affinity 0.9517 9 247
2h4h-assembly1.cif.gz_A sir2 h116y mutant-p53 peptide-nad 0.9507 9 247
2h4f-assembly1.cif.gz_A sir2-p53 peptide-nad+ 0.947 9 247
2h4j-assembly1.cif.gz_A sir2-deacetylated peptide (from enzymatic turnover in crystal) 0.9458 9 247
ID Description Score Start End Superfamily
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9587 6 247 3.40.50.1220
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9303 1 249 3.40.50.1220
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9154 6 247 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9057 9 249 3.40.50.1220
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8888 1 249 3.40.50.1220
ID Description Score Start End GO Terms
AF-X1KN05-F1-model_v4 Deacetylase sirtuin-type domain-containing protein 0.9667 53 249 GO:0017136
GO:0070403
AF-G7VFI2-F1-model_v4 NAD-dependent deacetylase 0.9644 48 249 GO:0017136
GO:0046872
GO:0070403
AF-A0A2H5VHG0-F1-model_v4 NAD-dependent protein deacetylase (EC 3.5.1.-) 0.9592 51 243 GO:0016787
GO:0017136
GO:0046872
GO:0070403
AF-A0A6J4TFW8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9589 36 249 GO:0017136
GO:0046872
GO:0070403
AF-A0A6L9IGU0-F1-model_v4 Deacetylase sirtuin-type domain-containing protein 0.9575 80 249 GO:0017136
GO:0046872
GO:0070403

Feature Viewer

pLDDT pTM Quality
86.39 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map