F158436

General Info

Members Datasets Scaffolds Average Seq Length
134 86 127 187

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10182925|rootL2_101829251
Length 205
Sequence LSILYPPGCWYYKLVLTQKLMRESSVKEKLIDVAGRLFHKQGYNLTGINQVIEEADIARGSMYNHFQSKTDLLIAYLEHFQEGWYRSAEEFLRPITDPKKRLLALFDYRIRRQQRVEFSGCPFTKISAEIGPEEGDVLKKVQKFKDSLRSYIAGMVAQVKHRNILTNEALTEMIYLMMEGGLVSAAIYKNADDLKRGKKIIEQLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
3 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
4 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
5 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
6 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
7 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
8 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
66 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
67 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
68 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
69 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
70 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
85 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 0
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 1.49
Rhizosphere 74.63
Stem 0
Stem Tuber 0
Unclassified 19.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2402449 2162886007 Bacteria 2939
2 rootH1_10112342 3300003316 Unclassified 2014
3 rootH1_10179173 3300003316 Bacteria 1248
4 rootH2_10004553 3300003320 Bacteria 89512
5 rootH2_10030091 3300003320 Bacteria 6427
6 rootH2_10035103 3300003320 Bacteria 20024
7 rootH2_10043986 3300003320 Bacteria 14600
8 rootL2_10023968 3300003322 Bacteria 2652
9 rootL2_10164456 3300003322 Bacteria 7741
10 rootL2_10182925 3300003322 Bacteria 2110
11 rootH1_10011329 3300003323 Bacteria 14978
12 rootH1_10097450 3300003323 Bacteria 2127
13 Ga0055531_10000063 3300003794 Bacteria 119938
14 Ga0065704_10070284 3300005289 Bacteria 39613
15 Ga0070658_10200591 3300005327 Bacteria 1683
16 Ga0070683_100012362 3300005329 Bacteria 7416
17 Ga0068868_100065014 3300005338 Bacteria 2897
18 Ga0070660_100021527 3300005339 Bacteria 4757
19 Ga0070691_10035418 3300005341 Bacteria 2350
20 Ga0070673_100220759 3300005364 Bacteria 1640
21 Ga0070659_100000731 3300005366 Bacteria 23826
22 Ga0070684_100001816 3300005535 Bacteria 15614
23 Ga0068853_100013764 3300005539 Bacteria 6609
24 Ga0070665_100002614 3300005548 Bacteria 19649
25 Ga0068855_100000556 3300005563 Bacteria 45792
26 Ga0068855_100048117 3300005563 Bacteria 5034
27 Ga0068854_100588365 3300005578 Bacteria 948
28 Ga0068852_101170736 3300005616 Unclassified 790
29 Ga0097621_100093876 3300006237 Unclassified 2515
30 Ga0068871_100157192 3300006358 Unclassified 1942
31 Ga0105240_10000033 3300009093 Bacteria 279600
32 Ga0105240_10000396 3300009093 Bacteria 81252
33 Ga0105240_10002129 3300009093 Bacteria 32328
34 Ga0105240_10021607 3300009093 Bacteria 8559
35 Ga0105240_10036892 3300009093 Bacteria 6284
36 Ga0105240_10048610 3300009093 Bacteria 5360
37 Ga0105240_10060288 3300009093 Bacteria 4730
38 Ga0105240_10107777 3300009093 Bacteria 3377
39 Ga0105240_10889620 3300009093 Bacteria 959
40 Ga0105237_10000052 3300009545 Bacteria 160459
41 Ga0105237_10004030 3300009545 Bacteria 17163
42 Ga0105237_10041224 3300009545 Bacteria 4657
43 Ga0105237_10302588 3300009545 Bacteria 1602
44 Ga0105237_10714413 3300009545 Unclassified 1009
45 Ga0105238_10048829 3300009551 Bacteria 4264
46 Ga0105238_10483571 3300009551 Bacteria 1238
47 Ga0105239_10000896 3300010375 Bacteria 42315
48 Ga0105239_10014470 3300010375 Bacteria 8756
49 Ga0105239_10016649 3300010375 Bacteria 8126
50 Ga0105239_10038751 3300010375 Bacteria 5221
51 Ga0105239_10087362 3300010375 Unclassified 3437
52 Ga0105239_10190796 3300010375 Unclassified 2294
53 Ga0157373_10126025 3300013100 Bacteria 1801
54 Ga0157370_10280675 3300013104 Bacteria 1539
55 Ga0157369_10030222 3300013105 Bacteria 5976
56 Ga0157374_10000002 3300013296 Bacteria 1054226
57 Ga0157378_11581960 3300013297 Unclassified 701
58 Ga0163162_10023376 3300013306 Bacteria 6101
59 Ga0163162_10081412 3300013306 Bacteria 3308
60 Ga0163162_11197906 3300013306 Unclassified 862
61 Ga0157372_10012554 3300013307 Bacteria 9021
62 Ga0157372_10117120 3300013307 Bacteria 3055
63 Ga0157375_10000771 3300013308 Bacteria 28093
64 Ga0163163_10112443 3300014325 Bacteria 2752
65 Ga0163163_10183204 3300014325 Bacteria 2142
66 Ga0157376_10010852 3300014969 Bacteria 6688
67 Ga0157376_10028059 3300014969 Unclassified 4470
68 Ga0157376_10064945 3300014969 Unclassified 3079
69 Ga0209257_1000008 3300025304 Bacteria 1294570
70 Ga0207647_10199528 3300025904 Bacteria 1158
71 Ga0207705_10156873 3300025909 Bacteria 1708
72 Ga0207695_10000023 3300025913 Bacteria 657903
73 Ga0207695_10000031 3300025913 Bacteria 526801
74 Ga0207695_10000110 3300025913 Bacteria 250079
75 Ga0207695_10013409 3300025913 Bacteria 9776
76 Ga0207695_10016801 3300025913 Bacteria 8545
77 Ga0207695_10019693 3300025913 Bacteria 7760
78 Ga0207695_10168953 3300025913 Bacteria 2114
79 Ga0207671_10000974 3300025914 Bacteria 35495
80 Ga0207671_10011759 3300025914 Bacteria 7089
81 Ga0207671_10248618 3300025914 Bacteria 1398
82 Ga0207657_10032013 3300025919 Bacteria 4757
83 Ga0207694_10142064 3300025924 Bacteria 1931
84 Ga0207694_11050399 3300025924 Unclassified 689
85 Ga0207690_10000596 3300025932 Bacteria 23410
86 Ga0207661_10004413 3300025944 Bacteria 9870
87 Ga0207667_10000926 3300025949 Bacteria 37457
88 Ga0207639_10013595 3300026041 Bacteria 5704
89 Ga0207648_11184769 3300026089 Bacteria 717
90 Ga0207698_10080386 3300026142 Bacteria 2626
91 Ga0268266_10002495 3300028379 Bacteria 19648
92 Ga0307515_10153549 3300028794 Bacteria 2391
93 Ga0307515_10234729 3300028794 Bacteria 1618
94 Ga0307511_10000046 3300030521 Bacteria 100284
95 Ga0265327_10039647 3300031251 Bacteria 2556
96 Ga0307509_10203311 3300031507 Bacteria 1815
97 Ga0307514_10062137 3300031649 Bacteria 2842
98 Ga0307414_10407885 3300032004 Bacteria 1182
99 Ga0307510_10034424 3300033180 Bacteria 5672
100 Ga0400483_014129 3300039062 Bacteria 1800
101 Ga0451793_0686014 3300041452 Bacteria 553
102 Ga0451841_0457587 3300041498 Bacteria 652
103 Ga0439431_0000772 3300041997 Bacteria 6920
104 Ga0439445_0144723 3300042004 Unclassified 690
105 Ga0466982_0225356 3300044672 Bacteria 1110
106 Ga0466964_0026359 3300044706 Bacteria 2275
107 Ga0495627_031292 3300046453 Bacteria 1681
108 Ga0495638_0175546 3300046460 Bacteria 1226
109 Ga0495596_0002968 3300046500 Bacteria 8799
110 Ga0495606_0005286 3300046507 Bacteria 12443
111 Ga0495606_0027082 3300046507 Bacteria 4071
112 Ga0495668_0008055 3300046616 Bacteria 6636
113 Ga0495611_0000209 3300046648 Bacteria 41348
114 Ga0495686_0000004 3300047472 Bacteria 869019
115 Ga0495686_0000034 3300047472 Bacteria 325038
116 Ga0495686_0000524 3300047472 Bacteria 55256
117 Ga0495686_0001954 3300047472 Bacteria 20511
118 Ga0495686_0177449 3300047472 Bacteria 1236
119 Ga0496101_0832609 3300048904 Bacteria 727
120 Ga0496116_0000642 3300048919 Bacteria 45587
121 Ga0496125_0043353 3300048928 Bacteria 3820
122 Ga0496125_0064173 3300048928 Bacteria 2921
123 Ga0496126_0048202 3300048929 Bacteria 3895
124 Ga0500583_0103084 3300053092 Bacteria 1399
125 Ga0500618_002441 3300053125 Bacteria 7008
126 Ga0500604_0051097 3300053151 Bacteria 1276
127 Ga0500616_0021038 3300053153 Bacteria 3662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0686014 Ga0451793_0686014_19_498 155
2 3300041498 Ga0451841_0457587 Ga0451841_0457587_10_492 155
3 3300046507 Ga0495606_0027082 Ga0495606_0027082_838_1371 175
4 3300039062 Ga0400483_014129 Ga0400483_014129_1210_1761 183
5 iso_pu_bacteria 2585428060 2587745757 183
6 iso_pu_bacteria 2588253712 2588445450 183
7 iso_pu_bacteria 2728369107 2729202823 183
8 iso_pu_bacteria 2739367874 2740061193 183
9 iso_pu_bacteria 2881955468 2881957847 183
10 3300003316 rootH1_10112342 rootH1_101123422 184
11 3300003320 rootH2_10030091 rootH2_100300913 184
12 3300003320 rootH2_10035103 rootH2_100351035 184
13 3300003320 rootH2_10043986 rootH2_100439862 184
14 3300005329 Ga0070683_100012362 Ga0070683_1000123622 184
15 3300005341 Ga0070691_10035418 Ga0070691_100354181 184
16 3300005535 Ga0070684_100001816 Ga0070684_1000018165 184
17 3300005539 Ga0068853_100013764 Ga0068853_1000137644 184
18 3300005548 Ga0070665_100002614 Ga0070665_1000026147 184
19 3300005563 Ga0068855_100000556 Ga0068855_10000055615 184
20 3300005578 Ga0068854_100588365 Ga0068854_1005883652 184
21 3300005616 Ga0068852_101170736 Ga0068852_1011707361 184
22 3300009093 Ga0105240_10000033 Ga0105240_100000339 184
23 3300009093 Ga0105240_10000396 Ga0105240_100003969 184
24 3300009093 Ga0105240_10002129 Ga0105240_100021297 184
25 3300009093 Ga0105240_10036892 Ga0105240_100368923 184
26 3300009093 Ga0105240_10048610 Ga0105240_100486101 184
27 3300009545 Ga0105237_10041224 Ga0105237_100412246 184
28 3300009545 Ga0105237_10302588 Ga0105237_103025882 184
29 3300009545 Ga0105237_10714413 Ga0105237_107144132 184
30 3300009551 Ga0105238_10048829 Ga0105238_100488292 184
31 3300009551 Ga0105238_10483571 Ga0105238_104835712 184
32 3300010375 Ga0105239_10000896 Ga0105239_100008964 184
33 3300010375 Ga0105239_10014470 Ga0105239_100144706 184
34 3300010375 Ga0105239_10038751 Ga0105239_100387513 184
35 3300010375 Ga0105239_10190796 Ga0105239_101907962 184
36 3300013100 Ga0157373_10126025 Ga0157373_101260252 184
37 3300013104 Ga0157370_10280675 Ga0157370_102806751 184
38 3300013105 Ga0157369_10030222 Ga0157369_100302223 184
39 3300013296 Ga0157374_10000002 Ga0157374_1000000233 184
40 3300013297 Ga0157378_11581960 Ga0157378_115819601 184
41 3300013306 Ga0163162_11197906 Ga0163162_111979062 184
42 3300013307 Ga0157372_10012554 Ga0157372_100125544 184
43 3300013307 Ga0157372_10117120 Ga0157372_101171203 184
44 3300014325 Ga0163163_10112443 Ga0163163_101124432 184
45 3300014969 Ga0157376_10010852 Ga0157376_100108527 184
46 3300025904 Ga0207647_10199528 Ga0207647_101995282 184
47 3300025913 Ga0207695_10000023 Ga0207695_10000023315 184
48 3300025913 Ga0207695_10000031 Ga0207695_10000031258 184
49 3300025913 Ga0207695_10000110 Ga0207695_1000011017 184
50 3300025913 Ga0207695_10013409 Ga0207695_100134097 184
51 3300025913 Ga0207695_10019693 Ga0207695_100196936 184
52 3300025914 Ga0207671_10000974 Ga0207671_1000097417 184
53 3300025914 Ga0207671_10248618 Ga0207671_102486182 184
54 3300025924 Ga0207694_10142064 Ga0207694_101420642 184
55 3300025924 Ga0207694_11050399 Ga0207694_110503991 184
56 3300025944 Ga0207661_10004413 Ga0207661_1000441310 184
57 3300025949 Ga0207667_10000926 Ga0207667_1000092614 184
58 3300026041 Ga0207639_10013595 Ga0207639_100135952 184
59 3300026142 Ga0207698_10080386 Ga0207698_100803862 184
60 3300028379 Ga0268266_10002495 Ga0268266_1000249514 184
61 3300031507 Ga0307509_10203311 Ga0307509_102033112 184
62 3300033180 Ga0307510_10034424 Ga0307510_100344242 184
63 3300044706 Ga0466964_0026359 Ga0466964_0026359_151_708 184
64 3300046507 Ga0495606_0005286 Ga0495606_0005286_5424_5981 184
65 3300046648 Ga0495611_0000209 Ga0495611_0000209_38566_39123 184
66 3300047472 Ga0495686_0000004 Ga0495686_0000004_729758_730312 184
67 3300053092 Ga0500583_0103084 Ga0500583_0103084_473_1030 184
68 iso_pu_bacteria 2919186247 2919187534 184
69 iso_pu_bacteria 2939664404 2939665200 184
70 3300003322 rootL2_10164456 rootL2_101644566 185
71 3300003323 rootH1_10011329 rootH1_1001132914 185
72 3300003323 rootH1_10097450 rootH1_100974502 185
73 3300003794 Ga0055531_10000063 Ga0055531_100000636 185
74 3300005338 Ga0068868_100065014 Ga0068868_1000650144 185
75 3300005364 Ga0070673_100220759 Ga0070673_1002207591 185
76 3300009093 Ga0105240_10060288 Ga0105240_100602882 185
77 3300009093 Ga0105240_10889620 Ga0105240_108896202 185
78 3300013306 Ga0163162_10081412 Ga0163162_100814123 185
79 3300014325 Ga0163163_10183204 Ga0163163_101832042 185
80 3300025304 Ga0209257_1000008 Ga0209257_1000008828 185
81 3300025913 Ga0207695_10168953 Ga0207695_101689532 185
82 3300030521 Ga0307511_10000046 Ga0307511_1000004676 185
83 3300041997 Ga0439431_0000772 Ga0439431_0000772_3661_4218 185
84 3300042004 Ga0439445_0144723 Ga0439445_0144723_106_663 185
85 3300044672 Ga0466982_0225356 Ga0466982_0225356_350_907 185
86 3300046616 Ga0495668_0008055 Ga0495668_0008055_1052_1609 185
87 3300047472 Ga0495686_0000034 Ga0495686_0000034_275934_276491 185
88 3300047472 Ga0495686_0000524 Ga0495686_0000524_16343_16906 185
89 3300047472 Ga0495686_0001954 Ga0495686_0001954_3370_3933 185
90 3300047472 Ga0495686_0177449 Ga0495686_0177449_409_972 185
91 3300048904 Ga0496101_0832609 Ga0496101_0832609_113_676 185
92 3300048929 Ga0496126_0048202 Ga0496126_0048202_1420_1983 185
93 3300053125 Ga0500618_002441 Ga0500618_002441_2517_3080 185
94 3300053151 Ga0500604_0051097 Ga0500604_0051097_312_869 185
95 3300005563 Ga0068855_100048117 Ga0068855_1000481174 186
96 3300009093 Ga0105240_10107777 Ga0105240_101077774 186
97 3300009545 Ga0105237_10000052 Ga0105237_1000005245 186
98 3300009545 Ga0105237_10004030 Ga0105237_1000403011 186
99 3300010375 Ga0105239_10016649 Ga0105239_100166495 186
100 3300025914 Ga0207671_10011759 Ga0207671_100117592 186
101 3300026089 Ga0207648_11184769 Ga0207648_111847691 186
102 2162886007 SwRhRL2b_contig_2402449 SwRhRL2b_0655.00003130 187
103 3300003316 rootH1_10179173 rootH1_101791732 187
104 3300003320 rootH2_10004553 rootH2_1000455361 187
105 3300003322 rootL2_10023968 rootL2_100239682 187
106 3300003322 rootL2_10182925 rootL2_101829251 187
107 3300005289 Ga0065704_10070284 Ga0065704_1007028411 187
108 3300005327 Ga0070658_10200591 Ga0070658_102005911 187
109 3300005339 Ga0070660_100021527 Ga0070660_1000215272 187
110 3300005366 Ga0070659_100000731 Ga0070659_10000073111 187
111 3300006237 Ga0097621_100093876 Ga0097621_1000938761 187
112 3300006358 Ga0068871_100157192 Ga0068871_1001571922 187
113 3300009093 Ga0105240_10021607 Ga0105240_100216076 187
114 3300010375 Ga0105239_10087362 Ga0105239_100873624 187
115 3300013306 Ga0163162_10023376 Ga0163162_100233762 187
116 3300013308 Ga0157375_10000771 Ga0157375_1000077120 187
117 3300014969 Ga0157376_10028059 Ga0157376_100280593 187
118 3300014969 Ga0157376_10064945 Ga0157376_100649454 187
119 3300025909 Ga0207705_10156873 Ga0207705_101568732 187
120 3300025913 Ga0207695_10016801 Ga0207695_1001680111 187
121 3300025919 Ga0207657_10032013 Ga0207657_100320132 187
122 3300025932 Ga0207690_10000596 Ga0207690_1000059611 187
123 3300028794 Ga0307515_10153549 Ga0307515_101535492 187
124 3300028794 Ga0307515_10234729 Ga0307515_102347292 187
125 3300031251 Ga0265327_10039647 Ga0265327_100396472 187
126 3300031649 Ga0307514_10062137 Ga0307514_100621372 187
127 3300032004 Ga0307414_10407885 Ga0307414_104078852 187
128 3300046453 Ga0495627_031292 Ga0495627_031292_287_850 187
129 3300046460 Ga0495638_0175546 Ga0495638_0175546_321_884 187
130 3300046500 Ga0495596_0002968 Ga0495596_0002968_1123_1686 187
131 3300048919 Ga0496116_0000642 Ga0496116_0000642_29454_30017 187
132 3300048928 Ga0496125_0043353 Ga0496125_0043353_894_1460 187
133 3300048928 Ga0496125_0064173 Ga0496125_0064173_2098_2661 187
134 3300053153 Ga0500616_0021038 Ga0500616_0021038_1167_1733 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

30

76

0.97

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

98

201

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8866 8 92
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.8725 6 186
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.8655 1 186
4yze-assembly1.cif.gz_C crystal structure of e.coli nemr reduced form 0.8634 8 187
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8595 4 183
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9895 8 54 1.10.10.60
1jtyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9726 8 54 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9726 8 54 1.10.10.60
1jupA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.972 8 54 1.10.10.60
3bt9A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9707 8 54 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A086BJC2-F1-model_v4 HTH tetR-type domain-containing protein 0.989 1 187 GO:0003677
GO:0006355
AF-A0A1H4GQI4-F1-model_v4 Transcriptional regulator, TetR family 0.9695 3 187 GO:0003677
GO:0006355
AF-A0A7K0ENS1-F1-model_v4 TetR family transcriptional regulator 0.9689 3 187 GO:0003677
GO:0006355
AF-A0A7K0ENS1-F1-model_v4 TetR family transcriptional regulator 0.9638 3 187 GO:0003677
GO:0006355
AF-A0A2T7BCB9-F1-model_v4 HTH tetR-type domain-containing protein 0.9612 8 186 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
94.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map