F157529

General Info

Members Datasets Scaffolds Average Seq Length
133 101 266 100

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0579796|Ga0495668_0579796_41_346
Length 88
Sequence MHILHVHIRVKPEAVETFKTVSLANAQATVQEPGVARFDVCQQADDPTRFILVEVYRELAGHAAVAPMMAEPRTAVKFTNLFPGDSGW

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
56 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
69 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 18.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0579796 3300046616 Unclassified 619
2 Ga0070683_100069694 3300005329 Bacteria 3279
3 Ga0070690_100072100 3300005330 Bacteria 2245
4 Ga0070687_101166861 3300005343 Bacteria 566
5 Ga0070688_101385926 3300005365 Bacteria 569
6 Ga0070694_100369801 3300005444 Unclassified 1115
7 Ga0070694_100747779 3300005444 Bacteria 798
8 Ga0070681_10231855 3300005458 Bacteria 1761
9 Ga0070681_10429419 3300005458 Bacteria 1233
10 Ga0070681_10540182 3300005458 Bacteria 1079
11 Ga0070685_10486362 3300005466 Unclassified 871
12 Ga0070699_101760635 3300005518 Unclassified 567
13 Ga0070679_100034421 3300005530 Bacteria 5020
14 Ga0070684_100251604 3300005535 Unclassified 1615
15 Ga0068853_100104833 3300005539 Bacteria 2504
16 Ga0068853_100461683 3300005539 Bacteria 1195
17 Ga0068855_100596231 3300005563 Bacteria 1192
18 Ga0068855_101034175 3300005563 Bacteria 861
19 Ga0068857_100587501 3300005577 Bacteria 1052
20 Ga0068856_100504130 3300005614 Bacteria 1231
21 Ga0068856_100774321 3300005614 Bacteria 979
22 Ga0068859_100337490 3300005617 Bacteria 1601
23 Ga0068859_100412165 3300005617 Unclassified 1447
24 Ga0068851_10449733 3300005834 Bacteria 765
25 Ga0081539_10129567 3300005985 Bacteria 1241
26 Ga0070712_100741920 3300006175 Bacteria 840
27 Ga0075428_100003127 3300006844 Bacteria 18080
28 Ga0075431_100068053 3300006847 Unclassified 3675
29 Ga0075436_100255443 3300006914 Bacteria 1249
30 Ga0075436_101037505 3300006914 Bacteria 616
31 Ga0097620_100337519 3300006931 Bacteria 1601
32 Ga0097620_100412167 3300006931 Unclassified 1447
33 Ga0075435_100379439 3300007076 Bacteria 1214
34 Ga0105240_10117761 3300009093 Bacteria 3202
35 Ga0111539_10018634 3300009094 Bacteria 8598
36 Ga0105245_11300549 3300009098 Bacteria 776
37 Ga0114129_10997662 3300009147 Bacteria 1055
38 Ga0114129_12307784 3300009147 Bacteria 646
39 Ga0105248_11171794 3300009177 Bacteria 869
40 Ga0105238_10031008 3300009551 Bacteria 5443
41 Ga0105238_11163294 3300009551 Unclassified 795
42 Ga0105238_11434595 3300009551 Bacteria 718
43 Ga0105238_11769319 3300009551 Bacteria 650
44 Ga0105238_12531192 3300009551 Unclassified 549
45 Ga0105239_11313095 3300010375 Bacteria 835
46 Ga0157370_10533542 3300013104 Bacteria 1076
47 Ga0157374_10312364 3300013296 Bacteria 1556
48 Ga0157374_11245925 3300013296 Unclassified 765
49 Ga0157378_10337310 3300013297 Bacteria 1469
50 Ga0157372_10269032 3300013307 Unclassified 1980
51 Ga0157372_10710391 3300013307 Bacteria 1169
52 Ga0163163_10111685 3300014325 Bacteria 2762
53 Ga0157377_11012028 3300014745 Unclassified 630
54 Ga0157379_11170323 3300014968 Unclassified 739
55 Ga0213876_10139632 3300021384 Bacteria 1288
56 Ga0207707_10334887 3300025912 Bacteria 1305
57 Ga0207707_10346730 3300025912 Bacteria 1280
58 Ga0207695_10571871 3300025913 Bacteria 1011
59 Ga0207693_10235240 3300025915 Bacteria 1439
60 Ga0207662_11093896 3300025918 Bacteria 567
61 Ga0207652_10107091 3300025921 Bacteria 2475
62 Ga0207694_10011920 3300025924 Bacteria 6555
63 Ga0207661_10019588 3300025944 Bacteria 5049
64 Ga0207667_10083941 3300025949 Bacteria 3298
65 Ga0207667_10589498 3300025949 Bacteria 1122
66 Ga0207639_10325048 3300026041 Bacteria 1367
67 Ga0207639_10419304 3300026041 Bacteria 1210
68 Ga0207702_10325347 3300026078 Bacteria 1465
69 Ga0207641_11357640 3300026088 Unclassified 712
70 Ga0207676_10273799 3300026095 Unclassified 1530
71 Ga0265326_10042757 3300028558 Bacteria 1286
72 Ga0265326_10116957 3300028558 Bacteria 758
73 Ga0265334_10005287 3300028573 Bacteria 5647
74 Ga0265318_10112508 3300028577 Bacteria 1001
75 Ga0265323_10000241 3300028653 Bacteria 32239
76 Ga0265323_10000372 3300028653 Bacteria 25874
77 Ga0265323_10026864 3300028653 Bacteria 2167
78 Ga0265322_10000211 3300028654 Bacteria 25677
79 Ga0307515_10926469 3300028794 Bacteria 505
80 Ga0265338_10010740 3300028800 Bacteria 10687
81 Ga0265338_10025832 3300028800 Bacteria 5944
82 Ga0265338_10101564 3300028800 Bacteria 2341
83 Ga0265338_10106152 3300028800 Bacteria 2275
84 Ga0307511_10143971 3300030521 Bacteria 1390
85 Ga0265330_10015796 3300031235 Bacteria 3489
86 Ga0265330_10143983 3300031235 Bacteria 1013
87 Ga0265332_10055014 3300031238 Bacteria 1706
88 Ga0265328_10236622 3300031239 Unclassified 697
89 Ga0265329_10008593 3300031242 Bacteria 3863
90 Ga0265339_10394509 3300031249 Unclassified 647
91 Ga0265316_10007045 3300031344 Bacteria 10653
92 Ga0265316_10018484 3300031344 Bacteria 5988
93 Ga0265316_10021407 3300031344 Bacteria 5476
94 Ga0265314_10041571 3300031711 Bacteria 3288
95 Ga0265314_10139223 3300031711 Bacteria 1503
96 Ga0265342_10035252 3300031712 Bacteria 3064
97 Ga0316583_10175014 3300032133 Bacteria 747
98 Ga0373926_0452676 3300035083 Unclassified 509
99 Ga0373944_0047016 3300035089 Bacteria 1351
100 Ga0373936_0403476 3300035113 Bacteria 628
101 Ga0373943_0248013 3300035170 Bacteria 999
102 Ga0373946_0042297 3300035171 Bacteria 1872
103 Ga0373935_0008939 3300035692 Bacteria 5996
104 Ga0373927_0043418 3300035695 Bacteria 2910
105 Ga0373947_0002777 3300035725 Bacteria 10465
106 Ga0373925_0002244 3300037068 Bacteria 15651
107 Ga0436365_0258554 3300039437 Bacteria 4037
108 Ga0453684_0084335 3300044712 Bacteria 3951
109 Ga0466959_0266568 3300045049 Unclassified 1178
110 Ga0451576_0382562 3300045051 Bacteria 1475
111 Ga0451576_0541029 3300045051 Bacteria 1224
112 Ga0451576_1504267 3300045051 Bacteria 699
113 Ga0495590_0181539 3300046457 Bacteria 769
114 Ga0495582_0014021 3300046473 Bacteria 4415
115 Ga0495630_0157720 3300046517 Bacteria 1727
116 Ga0495622_0019710 3300046557 Bacteria 3141
117 Ga0495672_0229134 3300047320 Unclassified 913
118 Ga0495675_0668346 3300047444 Bacteria 584
119 Ga0501034_1053449 3300049571 Bacteria 696
120 Ga0501036_0438214 3300049572 Unclassified 1089
121 Ga0501043_0242851 3300049579 Bacteria 1389
122 Ga0501047_0392102 3300049581 Unclassified 1222
123 Ga0501070_0825044 3300049586 Bacteria 727
124 Ga0501083_0003884 3300049744 Bacteria 10494
125 Ga0501035_0749946 3300049822 Bacteria 784
126 Ga0501044_0015169 3300049823 Bacteria 8301
127 nmdc:mga05p37_1912790_c1 3300050507 Bacteria 566
128 nmdc:mga06r32_284998_c1 3300050510 Unclassified 1639
129 nmdc:mga08y16_51988_c1 3300050511 Bacteria 4287
130 nmdc:mga0rr50_353749_c1 3300050513 Bacteria 1236
131 nmdc:mga08x19_168265_c1 3300050514 Bacteria 1491
132 nmdc:mga08x19_949660_c1 3300050514 Unclassified 611
133 Ga0501082_0153301 3300060353 Bacteria 2002
134 Ga0495668_0579796
135 Ga0070683_100069694
136 Ga0070690_100072100
137 Ga0070687_101166861
138 Ga0070688_101385926
139 Ga0070694_100369801
140 Ga0070694_100747779
141 Ga0070681_10231855
142 Ga0070681_10429419
143 Ga0070681_10540182
144 Ga0070685_10486362
145 Ga0070699_101760635
146 Ga0070679_100034421
147 Ga0070684_100251604
148 Ga0068853_100104833
149 Ga0068853_100461683
150 Ga0068855_100596231
151 Ga0068855_101034175
152 Ga0068857_100587501
153 Ga0068856_100504130
154 Ga0068856_100774321
155 Ga0068859_100337490
156 Ga0068859_100412165
157 Ga0068851_10449733
158 Ga0081539_10129567
159 Ga0070712_100741920
160 Ga0075428_100003127
161 Ga0075431_100068053
162 Ga0075436_100255443
163 Ga0075436_101037505
164 Ga0097620_100337519
165 Ga0097620_100412167
166 Ga0075435_100379439
167 Ga0105240_10117761
168 Ga0111539_10018634
169 Ga0105245_11300549
170 Ga0114129_10997662
171 Ga0114129_12307784
172 Ga0105248_11171794
173 Ga0105238_10031008
174 Ga0105238_11163294
175 Ga0105238_11434595
176 Ga0105238_11769319
177 Ga0105238_12531192
178 Ga0105239_11313095
179 Ga0157370_10533542
180 Ga0157374_10312364
181 Ga0157374_11245925
182 Ga0157378_10337310
183 Ga0157372_10269032
184 Ga0157372_10710391
185 Ga0163163_10111685
186 Ga0157377_11012028
187 Ga0157379_11170323
188 Ga0213876_10139632
189 Ga0207707_10334887
190 Ga0207707_10346730
191 Ga0207695_10571871
192 Ga0207693_10235240
193 Ga0207662_11093896
194 Ga0207652_10107091
195 Ga0207694_10011920
196 Ga0207661_10019588
197 Ga0207667_10083941
198 Ga0207667_10589498
199 Ga0207639_10325048
200 Ga0207639_10419304
201 Ga0207702_10325347
202 Ga0207641_11357640
203 Ga0207676_10273799
204 Ga0265326_10042757
205 Ga0265326_10116957
206 Ga0265334_10005287
207 Ga0265318_10112508
208 Ga0265323_10000241
209 Ga0265323_10000372
210 Ga0265323_10026864
211 Ga0265322_10000211
212 Ga0307515_10926469
213 Ga0265338_10010740
214 Ga0265338_10025832
215 Ga0265338_10101564
216 Ga0265338_10106152
217 Ga0307511_10143971
218 Ga0265330_10015796
219 Ga0265330_10143983
220 Ga0265332_10055014
221 Ga0265328_10236622
222 Ga0265329_10008593
223 Ga0265339_10394509
224 Ga0265316_10007045
225 Ga0265316_10018484
226 Ga0265316_10021407
227 Ga0265314_10041571
228 Ga0265314_10139223
229 Ga0265342_10035252
230 Ga0316583_10175014
231 Ga0373926_0452676
232 Ga0373944_0047016
233 Ga0373936_0403476
234 Ga0373943_0248013
235 Ga0373946_0042297
236 Ga0373935_0008939
237 Ga0373927_0043418
238 Ga0373947_0002777
239 Ga0373925_0002244
240 Ga0436365_0258554
241 Ga0453684_0084335
242 Ga0466959_0266568
243 Ga0451576_0382562
244 Ga0451576_0541029
245 Ga0451576_1504267
246 Ga0495590_0181539
247 Ga0495582_0014021
248 Ga0495630_0157720
249 Ga0495622_0019710
250 Ga0495672_0229134
251 Ga0495675_0668346
252 Ga0501034_1053449
253 Ga0501036_0438214
254 Ga0501043_0242851
255 Ga0501047_0392102
256 Ga0501070_0825044
257 Ga0501083_0003884
258 Ga0501035_0749946
259 Ga0501044_0015169
260 nmdc:mga05p37_1912790_c1
261 nmdc:mga06r32_284998_c1
262 nmdc:mga08y16_51988_c1
263 nmdc:mga0rr50_353749_c1
264 nmdc:mga08x19_168265_c1
265 nmdc:mga08x19_949660_c1
266 Ga0501082_0153301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

1

65

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9822 1 95
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9728 2 97
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9721 1 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9694 2 93
4hl9-assembly3.cif.gz_F crystal structure of antibiotic biosynthesis monooxygenase 0.9685 1 94
ID Description Score Start End Superfamily
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9801 2 94 3.30.70.100
2omoE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9773 3 95 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9676 2 96 3.30.70.100
af_A3KQL1_329_418_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9658 4 93 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9641 2 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A524QHS1-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9985 1 82 GO:0004497
GO:0005829
AF-A0A850BT63-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9945 1 94 GO:0004497
GO:0005829
AF-L1JSE3-F1-model_v4 ABM domain-containing protein 0.9926 7 89 GO:0005829
GO:0016491
AF-A0A4U1JBZ0-F1-model_v4 ABM domain-containing protein 0.9898 2 96 GO:0005829
GO:0016491
AF-A0A3N9TUT1-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9897 2 94 GO:0004497

Map