F157344

General Info

Members Datasets Scaffolds Average Seq Length
133 92 266 355

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0014644|Ga0466960_0014644_1438_2622
Length 394
Sequence MRVLAAMSGGVDSAVAAALAVEAGHDVVGVHMALSRNRNQFRTGSRGCCSIEDASDARRAADVLGIPYYVWDLSERFEDTVVADFLAEYEAGRTPNPCVRCNEHIKFETLLEKATALGFDAVATGHYARVVDGPGGRELHRSPNAEKDQSYVLAVMGPERLAHAIFPLGEFASKAQVRAEAAARGLAVSAKPDSYDICFVADGDTRGFLRDRLGSRPGAVVDVDGTVVGEHDGAYAYTVGQRKGLALGRPAPDGRPRYVLDVQTSTNTIVVGPAELLTVDRIAGDKAVWFVDPATVPADGVTVQVRAHGAPVPARIVPSHEGTSLVAELDATTPLRGVAAGQSLVVYEGTRVLAQSTVTRAWRDTASPARYRSPAPEPASDDRAPVSRVRSGIS

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
29 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
30 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
31 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
32 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
33 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
36 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
39 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
46 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
47 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
48 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
49 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
52 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
55 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
56 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
57 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
58 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
59 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
60 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
61 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
62 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
63 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
66 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
67 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
68 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
77 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
78 2643221679 Angustibacter sp. Root456 Isolate Unclassified
79 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
80 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
81 2643221711 Terrabacter sp. Root85 Isolate Unclassified
82 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
83 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
84 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
85 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
86 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
87 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
88 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
89 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
90 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
91 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
92 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.72
Metatranscriptomes 0
Isolates 11.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 24.81
Rhizosphere 62.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0014644 3300044901 Bacteria 3364
2 Ga0070658_10002657 3300005327 Bacteria 14870
3 Ga0070683_100050741 3300005329 Bacteria 3842
4 Ga0070680_100014360 3300005336 Bacteria 6187
5 Ga0070680_100036421 3300005336 Bacteria 3975
6 Ga0070682_100044882 3300005337 Bacteria 2738
7 Ga0070681_10000009 3300005458 Bacteria 146582
8 Ga0070681_10004253 3300005458 Bacteria 13572
9 Ga0070679_100000163 3300005530 Bacteria 53457
10 Ga0070679_100080620 3300005530 Bacteria 3244
11 Ga0070679_100114446 3300005530 Bacteria 2683
12 Ga0070679_100121624 3300005530 Bacteria 2595
13 Ga0070679_100336409 3300005530 Bacteria 1458
14 Ga0070696_100001872 3300005546 Bacteria 13803
15 Ga0068856_100004890 3300005614 Bacteria 13267
16 Ga0068856_100156498 3300005614 Bacteria 2289
17 Ga0081455_10003440 3300005937 Bacteria 18194
18 Ga0105240_10102790 3300009093 Bacteria 3472
19 Ga0105245_10066437 3300009098 Bacteria 3264
20 Ga0105245_10092366 3300009098 Bacteria 2787
21 Ga0114129_10000056 3300009147 Bacteria 99329
22 Ga0105237_10013597 3300009545 Bacteria 8527
23 Ga0105239_10013241 3300010375 Bacteria 9167
24 Ga0157372_10096481 3300013307 Bacteria 3369
25 Ga0157375_10058404 3300013308 Bacteria 3816
26 Ga0157375_10154032 3300013308 Bacteria 2436
27 Ga0163163_10212249 3300014325 Bacteria 1985
28 Ga0207705_10001906 3300025909 Bacteria 16306
29 Ga0207705_10043739 3300025909 Bacteria 3217
30 Ga0207705_10236948 3300025909 Bacteria 1389
31 Ga0207707_10000458 3300025912 Bacteria 42371
32 Ga0207707_10004458 3300025912 Bacteria 12330
33 Ga0207695_10381958 3300025913 Bacteria 1294
34 Ga0207671_10042400 3300025914 Bacteria 3368
35 Ga0207660_10000405 3300025917 Bacteria 28469
36 Ga0207660_10000423 3300025917 Bacteria 27874
37 Ga0207660_10086548 3300025917 Bacteria 2314
38 Ga0207652_10000118 3300025921 Bacteria 87541
39 Ga0207652_10000455 3300025921 Bacteria 42150
40 Ga0207652_10224530 3300025921 Bacteria 1692
41 Ga0207687_10052660 3300025927 Bacteria 2841
42 Ga0207669_10168355 3300025937 Bacteria 1557
43 Ga0207683_10032689 3300026121 Bacteria 4520
44 Ga0265338_10035607 3300028800 Bacteria 4779
45 Ga0265320_10042358 3300031240 Bacteria 2259
46 Ga0265325_10022506 3300031241 Bacteria 3451
47 Ga0316579_10000919 3300031691 Bacteria 10233
48 Ga0316576_10045898 3300031727 Bacteria 3161
49 Ga0316576_10098245 3300031727 Bacteria 2186
50 Ga0316578_10147374 3300031728 Bacteria 1418
51 Ga0307405_10203088 3300031731 Bacteria 1441
52 Ga0316574_0054303 3300035398 Bacteria 2502
53 Ga0316584_0001474 3300036712 Bacteria 14137
54 Ga0395900_0082170 3300037418 Bacteria 3310
55 Ga0451797_0767905 3300041453 Bacteria 4564
56 Ga0451853_2604643 3300041512 Bacteria 8596
57 Ga0466966_0085147 3300044684 Bacteria 1965
58 Ga0466961_0102804 3300044693 Bacteria 1799
59 Ga0466957_0061051 3300044842 Bacteria 2312
60 Ga0466959_0091920 3300045049 Bacteria 2179
61 Ga0466967_0019922 3300045976 Bacteria 5409
62 Ga0466967_0200941 3300045976 Bacteria 1888
63 Ga0495628_0116197 3300046516 Bacteria 2055
64 Ga0495581_0096030 3300047315 Bacteria 1721
65 Ga0495684_0181727 3300047471 Bacteria 1559
66 Ga0496100_0010512 3300048903 Bacteria 5242
67 Ga0496101_0071516 3300048904 Bacteria 2543
68 Ga0496101_0530430 3300048904 Bacteria 931
69 Ga0496102_0012753 3300048905 Bacteria 7277
70 Ga0496102_0019373 3300048905 Bacteria 5994
71 Ga0496102_0026583 3300048905 Bacteria 5164
72 Ga0496103_0028487 3300048906 Bacteria 3390
73 Ga0496103_0034466 3300048906 Bacteria 3095
74 Ga0496103_0061155 3300048906 Bacteria 2342
75 Ga0496103_0139143 3300048906 Bacteria 1552
76 Ga0496104_0001987 3300048907 Bacteria 17732
77 Ga0496104_0111542 3300048907 Bacteria 2622
78 Ga0496105_0002168 3300048908 Bacteria 14218
79 Ga0496105_0022510 3300048908 Bacteria 5104
80 Ga0496106_0053587 3300048909 Bacteria 3047
81 Ga0496108_0010274 3300048911 Bacteria 7599
82 Ga0496108_0011627 3300048911 Bacteria 7161
83 Ga0496108_0063346 3300048911 Bacteria 3114
84 Ga0496109_0005561 3300048912 Bacteria 10552
85 Ga0496109_0009492 3300048912 Bacteria 8294
86 Ga0496109_0016318 3300048912 Bacteria 6490
87 Ga0496110_0012102 3300048913 Bacteria 7087
88 Ga0496110_0071320 3300048913 Bacteria 3080
89 Ga0496111_0000176 3300048914 Bacteria 28843
90 Ga0496111_0044314 3300048914 Bacteria 3198
91 Ga0496113_0082246 3300048916 Bacteria 2469
92 Ga0496114_0011965 3300048917 Bacteria 6942
93 Ga0496114_0020751 3300048917 Bacteria 5334
94 Ga0496114_0046273 3300048917 Bacteria 3616
95 Ga0496114_0090368 3300048917 Bacteria 2599
96 Ga0496114_0142901 3300048917 Bacteria 2073
97 Ga0496115_0175900 3300048918 Bacteria 1770
98 Ga0496121_0008177 3300048924 Bacteria 12421
99 Ga0496122_0000646 3300048925 Bacteria 70740
100 Ga0496123_0000405 3300048926 Bacteria 79019
101 Ga0496124_0001857 3300048927 Bacteria 29169
102 Ga0496125_0001474 3300048928 Bacteria 34047
103 Ga0496126_0000006 3300048929 Bacteria 798804
104 Ga0501034_0000954 3300049571 Bacteria 41786
105 Ga0501034_0120075 3300049571 Bacteria 2615
106 Ga0501034_0170488 3300049571 Bacteria 2144
107 Ga0501043_0160666 3300049579 Bacteria 1756
108 Ga0501069_0002042 3300049585 Bacteria 10128
109 Ga0501069_0106579 3300049585 Bacteria 1593
110 Ga0501070_0001715 3300049586 Bacteria 19394
111 Ga0501070_0005245 3300049586 Bacteria 11048
112 Ga0501080_0000044 3300049742 Bacteria 79921
113 Ga0501081_0056418 3300049743 Bacteria 2715
114 Ga0501083_0080476 3300049744 Bacteria 2160
115 Ga0501044_0035866 3300049823 Bacteria 5191
116 Ga0501044_0101146 3300049823 Bacteria 2900
117 nmdc:mga05p37_720_c1 3300050507 Bacteria 36593
118 Ga0501082_0034847 3300060353 Bacteria 4338
119 2644444026 2643221679 Bacteria 3839507
120 2644506769 2643221690 Bacteria 4654705
121 2644527754 2643221694 Bacteria 4392972
122 2644608857 2643221711 Bacteria 4865335
123 2644670625 2643221722 Bacteria 4247614
124 2812362157 2811994880 Bacteria 4147780
125 2812374016 2811994882 Bacteria 4688362
126 2819665709 2818991458 Bacteria 4794049
127 2819691128 2818991462 Bacteria 4320267
128 2819729015 2818991469 Bacteria 4644110
129 2835189577 2835188231 Bacteria 3476928
130 2848552768 2848551377 Bacteria 3720646
131 2884994581 2884994152 Bacteria 4492978
132 8055036293 8055034563 Bacteria 3562128
133 8055072827 8055066027 Bacteria 9479577
134 Ga0466960_0014644
135 Ga0070658_10002657
136 Ga0070683_100050741
137 Ga0070680_100014360
138 Ga0070680_100036421
139 Ga0070682_100044882
140 Ga0070681_10000009
141 Ga0070681_10004253
142 Ga0070679_100000163
143 Ga0070679_100080620
144 Ga0070679_100114446
145 Ga0070679_100121624
146 Ga0070679_100336409
147 Ga0070696_100001872
148 Ga0068856_100004890
149 Ga0068856_100156498
150 Ga0081455_10003440
151 Ga0105240_10102790
152 Ga0105245_10066437
153 Ga0105245_10092366
154 Ga0114129_10000056
155 Ga0105237_10013597
156 Ga0105239_10013241
157 Ga0157372_10096481
158 Ga0157375_10058404
159 Ga0157375_10154032
160 Ga0163163_10212249
161 Ga0207705_10001906
162 Ga0207705_10043739
163 Ga0207705_10236948
164 Ga0207707_10000458
165 Ga0207707_10004458
166 Ga0207695_10381958
167 Ga0207671_10042400
168 Ga0207660_10000405
169 Ga0207660_10000423
170 Ga0207660_10086548
171 Ga0207652_10000118
172 Ga0207652_10000455
173 Ga0207652_10224530
174 Ga0207687_10052660
175 Ga0207669_10168355
176 Ga0207683_10032689
177 Ga0265338_10035607
178 Ga0265320_10042358
179 Ga0265325_10022506
180 Ga0316579_10000919
181 Ga0316576_10045898
182 Ga0316576_10098245
183 Ga0316578_10147374
184 Ga0307405_10203088
185 Ga0316574_0054303
186 Ga0316584_0001474
187 Ga0395900_0082170
188 Ga0451797_0767905
189 Ga0451853_2604643
190 Ga0466966_0085147
191 Ga0466961_0102804
192 Ga0466957_0061051
193 Ga0466959_0091920
194 Ga0466967_0019922
195 Ga0466967_0200941
196 Ga0495628_0116197
197 Ga0495581_0096030
198 Ga0495684_0181727
199 Ga0496100_0010512
200 Ga0496101_0071516
201 Ga0496101_0530430
202 Ga0496102_0012753
203 Ga0496102_0019373
204 Ga0496102_0026583
205 Ga0496103_0028487
206 Ga0496103_0034466
207 Ga0496103_0061155
208 Ga0496103_0139143
209 Ga0496104_0001987
210 Ga0496104_0111542
211 Ga0496105_0002168
212 Ga0496105_0022510
213 Ga0496106_0053587
214 Ga0496108_0010274
215 Ga0496108_0011627
216 Ga0496108_0063346
217 Ga0496109_0005561
218 Ga0496109_0009492
219 Ga0496109_0016318
220 Ga0496110_0012102
221 Ga0496110_0071320
222 Ga0496111_0000176
223 Ga0496111_0044314
224 Ga0496113_0082246
225 Ga0496114_0011965
226 Ga0496114_0020751
227 Ga0496114_0046273
228 Ga0496114_0090368
229 Ga0496114_0142901
230 Ga0496115_0175900
231 Ga0496121_0008177
232 Ga0496122_0000646
233 Ga0496123_0000405
234 Ga0496124_0001857
235 Ga0496125_0001474
236 Ga0496126_0000006
237 Ga0501034_0000954
238 Ga0501034_0120075
239 Ga0501034_0170488
240 Ga0501043_0160666
241 Ga0501069_0002042
242 Ga0501069_0106579
243 Ga0501070_0001715
244 Ga0501070_0005245
245 Ga0501080_0000044
246 Ga0501081_0056418
247 Ga0501083_0080476
248 Ga0501044_0035866
249 Ga0501044_0101146
250 nmdc:mga05p37_720_c1
251 Ga0501082_0034847
252 2644444026
253 2644506769
254 2644527754
255 2644608857
256 2644670625
257 2812362157
258 2812374016
259 2819665709
260 2819691128
261 2819729015
262 2835189577
263 2848552768
264 2884994581
265 8055036293
266 8055072827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

1

202

0.98

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

206

273

0.97

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

279

358

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.8958 2 349
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.8927 2 349
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.8855 2 349
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.8812 2 349
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.8798 2 349
ID Description Score Start End Superfamily
af_P9WJS5_1_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9748 1 204 3.40.50.620
af_P9WJS5_1_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9655 1 204 3.40.50.620
af_P9WJS5_208_272_2.30.30.280 Mainly Beta;Roll;SH3 type barrels.;Adenine nucleotide alpha hydrolases-like domains 0.956 210 273 2.30.30.280
af_I1LJW0_290_349_2.30.30.280 Mainly Beta;Roll;SH3 type barrels.;Adenine nucleotide alpha hydrolases-like domains 0.938 210 267 2.30.30.280
af_Q2FXV6_278_371_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9302 273 349 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A6G3V9I7-F1-model_v4 deleted 0.9696 66 176
AF-A6W7K7-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.9677 1 350 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A1T6X1-F1-model_v4 tRNA-specific 2-thiouridylase MnmA (EC 2.8.1.13) 0.967 1 349 GO:0000049
GO:0002143
GO:0005524
GO:0005737
GO:0103016
AF-A0A120IPZ4-F1-model_v4 deleted 0.9668 1 206
AF-A0A496MWT5-F1-model_v4 tRNA-uridine 2-sulfurtransferase (EC 2.8.1.13) 0.9663 1 204 GO:0002143
GO:0103016

Map