F155128

General Info

Members Datasets Scaffolds Average Seq Length
133 95 266 134

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100929206|Ga0070670_1009292062
Length 158
Sequence MHSMKQELSAAFEVVRIVGLALPDVQAATKYDGSPVLRVGGSFMAGLATHESAEPDTLVVRAGFEERQRLIEDAPEAYYLTDYYRSYPLVLVRLSRIDRDALRDLLSVSRRLTLPKGRMRSGPGTLLKPSLGFPAEAPDGDGAKGSXXXXKRGRRRKG

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
77 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 50.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100929206 3300005331 Unclassified 789
2 Ga0065715_10108837 3300005293 Bacteria 2698
3 Ga0065707_10061906 3300005295 Bacteria 767
4 Ga0065707_10116644 3300005295 Bacteria 2232
5 Ga0070670_100179484 3300005331 Unclassified 1838
6 Ga0068869_100400331 3300005334 Bacteria 1129
7 Ga0068868_100753047 3300005338 Unclassified 875
8 Ga0068868_102283303 3300005338 Unclassified 516
9 Ga0070687_100643334 3300005343 Unclassified 734
10 Ga0070659_100959761 3300005366 Bacteria 749
11 Ga0070667_100051878 3300005367 Bacteria 3459
12 Ga0070703_10000880 3300005406 Bacteria 9644
13 Ga0070694_100051189 3300005444 Unclassified 2787
14 Ga0070708_100208766 3300005445 Unclassified 1830
15 Ga0070708_101032207 3300005445 Unclassified 771
16 Ga0070708_102210624 3300005445 Unclassified 508
17 Ga0070678_100372608 3300005456 Unclassified 1233
18 Ga0070662_100291638 3300005457 Bacteria 1323
19 Ga0068867_101517159 3300005459 Unclassified 624
20 Ga0070706_100000131 3300005467 Bacteria 92723
21 Ga0070707_100352267 3300005468 Unclassified 1430
22 Ga0070707_102182102 3300005468 Unclassified 521
23 Ga0070698_100271772 3300005471 Bacteria 1626
24 Ga0070698_100392482 3300005471 Unclassified 1321
25 Ga0070699_100819715 3300005518 Unclassified 852
26 Ga0070699_101066447 3300005518 Bacteria 741
27 Ga0070697_100892935 3300005536 Unclassified 788
28 Ga0070672_100209876 3300005543 Bacteria 1631
29 Ga0070695_100098355 3300005545 Unclassified 1966
30 Ga0070696_100931957 3300005546 Unclassified 722
31 Ga0070664_100557651 3300005564 Unclassified 1060
32 Ga0068856_100695246 3300005614 Bacteria 1037
33 Ga0070702_100028655 3300005615 Bacteria 3019
34 Ga0068859_100860721 3300005617 Bacteria 992
35 Ga0068861_100052347 3300005719 Unclassified 3102
36 Ga0068861_100186750 3300005719 Bacteria 1729
37 Ga0068860_100405787 3300005843 Bacteria 1349
38 Ga0068862_100012424 3300005844 Bacteria 7044
39 Ga0068862_100176080 3300005844 Unclassified 1918
40 Ga0068862_100471894 3300005844 Unclassified 1186
41 Ga0070717_10211815 3300006028 Bacteria 1701
42 Ga0075428_101181555 3300006844 Unclassified 807
43 Ga0075431_100072187 3300006847 Unclassified 3562
44 Ga0075431_100294238 3300006847 Bacteria 1641
45 Ga0075431_100434748 3300006847 Bacteria 1310
46 Ga0097620_100032964 3300006931 Bacteria 5203
47 Ga0097620_100860743 3300006931 Bacteria 992
48 Ga0075435_100070091 3300007076 Unclassified 2861
49 Ga0099794_10321045 3300007265 Unclassified 803
50 Ga0111539_10001201 3300009094 Bacteria 34487
51 Ga0111539_10001694 3300009094 Bacteria 29381
52 Ga0111539_10423368 3300009094 Bacteria 1551
53 Ga0111539_10428443 3300009094 Unclassified 1540
54 Ga0111539_11777498 3300009094 Unclassified 715
55 Ga0105247_10013689 3300009101 Bacteria 4864
56 Ga0114129_10088110 3300009147 Unclassified 4304
57 Ga0114129_10101239 3300009147 Bacteria 3986
58 Ga0105243_10990704 3300009148 Unclassified 842
59 Ga0105243_11432925 3300009148 Unclassified 712
60 Ga0105241_11851734 3300009174 Unclassified 590
61 Ga0105248_12492584 3300009177 Unclassified 589
62 Ga0105238_10854679 3300009551 Unclassified 927
63 Ga0157369_12017739 3300013105 Unclassified 585
64 Ga0163162_10078123 3300013306 Bacteria 3375
65 Ga0157375_11480463 3300013308 Unclassified 801
66 Ga0157379_10225946 3300014968 Bacteria 1697
67 Ga0157376_10252798 3300014969 Unclassified 1647
68 Ga0207642_10218052 3300025899 Bacteria 1065
69 Ga0207710_10062760 3300025900 Bacteria 1689
70 Ga0207688_10105678 3300025901 Bacteria 1630
71 Ga0207645_10733342 3300025907 Unclassified 672
72 Ga0207643_10580893 3300025908 Unclassified 720
73 Ga0207684_10000102 3300025910 Bacteria 162120
74 Ga0207684_10486032 3300025910 Unclassified 1059
75 Ga0207646_10264866 3300025922 Bacteria 1553
76 Ga0207646_10866981 3300025922 Unclassified 802
77 Ga0207681_10021248 3300025923 Bacteria 4123
78 Ga0207681_10100031 3300025923 Bacteria 2089
79 Ga0207650_10123156 3300025925 Unclassified 2021
80 Ga0207706_10132058 3300025933 Unclassified 2196
81 Ga0207670_10324326 3300025936 Bacteria 1213
82 Ga0207691_10032784 3300025940 Bacteria 4841
83 Ga0207691_10385226 3300025940 Bacteria 1197
84 Ga0207689_10212849 3300025942 Bacteria 1597
85 Ga0207689_11096515 3300025942 Unclassified 671
86 Ga0207712_10005030 3300025961 Bacteria 8366
87 Ga0207677_10708644 3300026023 Bacteria 894
88 Ga0207703_10191316 3300026035 Unclassified 1812
89 Ga0207708_10297351 3300026075 Unclassified 1312
90 Ga0207641_10103986 3300026088 Bacteria 2506
91 Ga0207676_10541107 3300026095 Unclassified 1111
92 Ga0207674_10028700 3300026116 Bacteria 5869
93 Ga0207675_100066752 3300026118 Unclassified 3363
94 Ga0207675_100186245 3300026118 Bacteria 1990
95 Ga0207683_10399080 3300026121 Bacteria 1265
96 Ga0207428_10003062 3300027907 Bacteria 16458
97 Ga0207428_10021703 3300027907 Bacteria 5432
98 Ga0268265_10025872 3300028380 Unclassified 4171
99 Ga0268265_10072133 3300028380 Bacteria 2692
100 Ga0268265_10436821 3300028380 Unclassified 1219
101 Ga0268265_11949088 3300028380 Unclassified 594
102 Ga0268264_10907400 3300028381 Unclassified 884
103 Ga0265316_10069308 3300031344 Unclassified 2722
104 Ga0265314_10066040 3300031711 Unclassified 2441
105 Ga0373931_0069913 3300035691 Unclassified 1914
106 Ga0450896_000973 3300042133 Bacteria 3328
107 Ga0439460_0072421 3300042461 Bacteria 1070
108 Ga0495629_0221562 3300046459 Bacteria 1305
109 Ga0495580_0313679 3300046472 Bacteria 1066
110 Ga0495580_0431902 3300046472 Unclassified 885
111 Ga0495582_0044470 3300046473 Bacteria 2446
112 Ga0495639_0681079 3300046475 Unclassified 531
113 Ga0495643_0006317 3300046522 Bacteria 7834
114 Ga0495645_0012609 3300046543 Bacteria 5960
115 Ga0495667_0384651 3300046559 Unclassified 885
116 Ga0495656_0360570 3300046615 Bacteria 755
117 Ga0495674_0190323 3300047319 Unclassified 1706
118 Ga0495680_0598471 3300047322 Unclassified 738
119 Ga0496102_0415246 3300048905 Unclassified 1264
120 Ga0496114_1505300 3300048917 Unclassified 561
121 nmdc:mga05p37_1941426_c1 3300050507 Unclassified 560
122 nmdc:mga05p37_201334_c1 3300050507 Bacteria 2411
123 nmdc:mga05p37_30328_c1 3300050507 Bacteria 6598
124 nmdc:mga05p37_51159_c1 3300050507 Bacteria 5081
125 nmdc:mga06r32_157189_c1 3300050510 Unclassified 2255
126 nmdc:mga06r32_258561_c1 3300050510 Unclassified 1729
127 nmdc:mga06r32_299777_c1 3300050510 Bacteria 1593
128 nmdc:mga06r32_413165_c1 3300050510 Unclassified 1331
129 nmdc:mga08y16_35941_c1 3300050511 Bacteria 5203
130 nmdc:mga08y16_704_c1 3300050511 Bacteria 31826
131 nmdc:mga08x19_186823_c1 3300050514 Bacteria 1417
132 Ga0495601_0182762 3300053077 Unclassified 1371
133 Ga0500592_005728 3300053116 Bacteria 1976
134 Ga0070670_100929206
135 Ga0065715_10108837
136 Ga0065707_10061906
137 Ga0065707_10116644
138 Ga0070670_100179484
139 Ga0068869_100400331
140 Ga0068868_100753047
141 Ga0068868_102283303
142 Ga0070687_100643334
143 Ga0070659_100959761
144 Ga0070667_100051878
145 Ga0070703_10000880
146 Ga0070694_100051189
147 Ga0070708_100208766
148 Ga0070708_101032207
149 Ga0070708_102210624
150 Ga0070678_100372608
151 Ga0070662_100291638
152 Ga0068867_101517159
153 Ga0070706_100000131
154 Ga0070707_100352267
155 Ga0070707_102182102
156 Ga0070698_100271772
157 Ga0070698_100392482
158 Ga0070699_100819715
159 Ga0070699_101066447
160 Ga0070697_100892935
161 Ga0070672_100209876
162 Ga0070695_100098355
163 Ga0070696_100931957
164 Ga0070664_100557651
165 Ga0068856_100695246
166 Ga0070702_100028655
167 Ga0068859_100860721
168 Ga0068861_100052347
169 Ga0068861_100186750
170 Ga0068860_100405787
171 Ga0068862_100012424
172 Ga0068862_100176080
173 Ga0068862_100471894
174 Ga0070717_10211815
175 Ga0075428_101181555
176 Ga0075431_100072187
177 Ga0075431_100294238
178 Ga0075431_100434748
179 Ga0097620_100032964
180 Ga0097620_100860743
181 Ga0075435_100070091
182 Ga0099794_10321045
183 Ga0111539_10001201
184 Ga0111539_10001694
185 Ga0111539_10423368
186 Ga0111539_10428443
187 Ga0111539_11777498
188 Ga0105247_10013689
189 Ga0114129_10088110
190 Ga0114129_10101239
191 Ga0105243_10990704
192 Ga0105243_11432925
193 Ga0105241_11851734
194 Ga0105248_12492584
195 Ga0105238_10854679
196 Ga0157369_12017739
197 Ga0163162_10078123
198 Ga0157375_11480463
199 Ga0157379_10225946
200 Ga0157376_10252798
201 Ga0207642_10218052
202 Ga0207710_10062760
203 Ga0207688_10105678
204 Ga0207645_10733342
205 Ga0207643_10580893
206 Ga0207684_10000102
207 Ga0207684_10486032
208 Ga0207646_10264866
209 Ga0207646_10866981
210 Ga0207681_10021248
211 Ga0207681_10100031
212 Ga0207650_10123156
213 Ga0207706_10132058
214 Ga0207670_10324326
215 Ga0207691_10032784
216 Ga0207691_10385226
217 Ga0207689_10212849
218 Ga0207689_11096515
219 Ga0207712_10005030
220 Ga0207677_10708644
221 Ga0207703_10191316
222 Ga0207708_10297351
223 Ga0207641_10103986
224 Ga0207676_10541107
225 Ga0207674_10028700
226 Ga0207675_100066752
227 Ga0207675_100186245
228 Ga0207683_10399080
229 Ga0207428_10003062
230 Ga0207428_10021703
231 Ga0268265_10025872
232 Ga0268265_10072133
233 Ga0268265_10436821
234 Ga0268265_11949088
235 Ga0268264_10907400
236 Ga0265316_10069308
237 Ga0265314_10066040
238 Ga0373931_0069913
239 Ga0450896_000973
240 Ga0439460_0072421
241 Ga0495629_0221562
242 Ga0495580_0313679
243 Ga0495580_0431902
244 Ga0495582_0044470
245 Ga0495639_0681079
246 Ga0495643_0006317
247 Ga0495645_0012609
248 Ga0495667_0384651
249 Ga0495656_0360570
250 Ga0495674_0190323
251 Ga0495680_0598471
252 Ga0496102_0415246
253 Ga0496114_1505300
254 nmdc:mga05p37_1941426_c1
255 nmdc:mga05p37_201334_c1
256 nmdc:mga05p37_30328_c1
257 nmdc:mga05p37_51159_c1
258 nmdc:mga06r32_157189_c1
259 nmdc:mga06r32_258561_c1
260 nmdc:mga06r32_299777_c1
261 nmdc:mga06r32_413165_c1
262 nmdc:mga08y16_35941_c1
263 nmdc:mga08y16_704_c1
264 nmdc:mga08x19_186823_c1
265 Ga0495601_0182762
266 Ga0500592_005728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cd7-assembly2.cif.gz_D crystal structure of the ntd l199m of drosophila oskar protein 0.8435 15 39
5a49-assembly4.cif.gz_D crystal structure of the lotus domain (aa 139-222) of drosophila oskar in c222 0.8333 15 39
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7731 15 112
5a49-assembly2.cif.gz_B crystal structure of the lotus domain (aa 139-222) of drosophila oskar in c222 0.7477 15 39
5a49-assembly1.cif.gz_H crystal structure of the lotus domain (aa 139-222) of drosophila oskar in c222 0.7387 15 42
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.811 13 109 3.30.70.1230
5a49E00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;LOTUS domain-like 0.776 15 42 3.30.420.610
af_Q19404_198_243_2.20.70.10 Mainly Beta;Single Sheet;Ubiquitin Ligase Nedd4; Chain: W;; 0.7738 22 39 2.20.70.10
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7732 15 112 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7687 13 113 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A2V8G5N7-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9791 23 120
AF-A0A2V8EAS1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9757 15 119
AF-A0A2U3KCH6-F1-model_v4 Uncharacterized protein 0.9751 12 115
AF-A0A2U3L8E0-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9711 9 120
AF-A0A7V0UFU2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9703 12 119 GO:0003677

Map