F154524

General Info

Members Datasets Scaffolds Average Seq Length
132 113 264 159

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862290372|2862293626
Length 192
Sequence PSGHPATHRWAVGVAPGIGRTIRIGLKIEEEAVLNDVDLGHLRRAVELAAEALEAGDEPFGSVLVAGDGTVLAEDRNRVGSGDHTRHPEFELARWSAGRLGPEERAAATVYTSTEHCPMCATAHGWVGLGRIVYASSSEQLGGWLAELGVPAPPVRTLPIRDLVPGLPVEGPVPELAAEVRTLHRRLHGRTD

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
31 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
32 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
33 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
34 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
35 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
36 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
37 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
38 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
39 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
40 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
41 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
42 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
43 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
44 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
45 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
54 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
55 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
56 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
57 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
58 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
59 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
60 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
61 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
65 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
78 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
79 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
83 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
84 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
85 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
86 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
87 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
88 2643221572 Leifsonia sp. Root60 Isolate Unclassified
89 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
90 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
91 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
92 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
93 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
94 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
95 2858950400 Achromobacter sp. K91 Isolate Unclassified
96 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
97 2862574272 Streptomyces sp. AcE210 Isolate Nodule
98 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
99 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
100 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
101 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
102 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
103 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
104 2941479691
105 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
106 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
107 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
108 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
109 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
110 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
111 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
112 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
113 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 78.03
Metatranscriptomes 0
Isolates 21.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.58
Nodule 0.76
Rhizoplane 2.27
Rhizosphere 70.45
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1013541 3300003354 Bacteria 2774
2 JGI25160J50197_1018427 3300003354 Bacteria 2176
3 JGI25407J50210_10018351 3300003373 Bacteria 1817
4 Ga0070660_100480894 3300005339 Bacteria 1032
5 Ga0070661_100392991 3300005344 Bacteria 1095
6 Ga0070668_100176894 3300005347 Bacteria 1741
7 Ga0070675_100255511 3300005354 Bacteria 1534
8 Ga0070685_10129197 3300005466 Bacteria 1578
9 Ga0068852_100895650 3300005616 Bacteria 904
10 Ga0081455_10216264 3300005937 Bacteria 1424
11 Ga0081538_10000202 3300005981 Bacteria 66057
12 Ga0081538_10001486 3300005981 Bacteria 24075
13 Ga0081538_10003252 3300005981 Bacteria 15439
14 Ga0081538_10014652 3300005981 Bacteria 6127
15 Ga0081538_10016620 3300005981 Bacteria 5631
16 Ga0081538_10017991 3300005981 Bacteria 5334
17 Ga0075363_100004714 3300006048 Bacteria 6002
18 Ga0075428_100770804 3300006844 Bacteria 1023
19 Ga0075431_100000633 3300006847 Bacteria 29722
20 Ga0111539_12048315 3300009094 Bacteria 664
21 Ga0105242_10517260 3300009176 Bacteria 1138
22 Ga0157371_10180236 3300013102 Bacteria 1511
23 Ga0183367_1003 3300015688 Bacteria 814276
24 Ga0207426_1002106 3300025302 Bacteria 13688
25 Ga0207426_1026488 3300025302 Bacteria 1941
26 Ga0207657_10254615 3300025919 Bacteria 1399
27 Ga0207659_11022613 3300025926 Bacteria 711
28 Ga0207668_10134919 3300025972 Bacteria 1890
29 Ga0207668_10515881 3300025972 Bacteria 1030
30 Ga0207640_10219658 3300025981 Bacteria 1454
31 Ga0207648_10091080 3300026089 Bacteria 2665
32 Ga0207698_10019132 3300026142 Bacteria 4681
33 Ga0307408_100926354 3300031548 Bacteria 799
34 Ga0307508_10024108 3300031616 Bacteria 5522
35 Ga0307516_10193834 3300031730 Bacteria 1756
36 Ga0307405_10412592 3300031731 Bacteria 1060
37 Ga0307410_10095181 3300031852 Bacteria 2123
38 Ga0307412_10103173 3300031911 Bacteria 2021
39 Ga0307409_100028272 3300031995 Bacteria 3991
40 Ga0307409_101474906 3300031995 Bacteria 707
41 Ga0307416_100148140 3300032002 Bacteria 2147
42 Ga0307416_100703339 3300032002 Bacteria 1100
43 Ga0307415_100011905 3300032126 Bacteria 5004
44 Ga0307415_100021029 3300032126 Bacteria 4000
45 Ga0307415_100179738 3300032126 Bacteria 1659
46 Ga0307415_100391412 3300032126 Bacteria 1183
47 Ga0439436_0022514 3300041404 Bacteria 1866
48 Ga0439439_0001850 3300041406 Bacteria 4351
49 Ga0451789_0055472 3300041443 Bacteria 689
50 Ga0451791_1405267 3300041451 Bacteria 753
51 Ga0451853_1072307 3300041512 Bacteria 524
52 Ga0451853_3992282 3300041512 Bacteria 698
53 Ga0439433_0000716 3300041999 Bacteria 6463
54 Ga0439442_022540 3300042002 Bacteria 1307
55 Ga0439448_0082051 3300042005 Bacteria 1083
56 Ga0439449_0049081 3300042007 Bacteria 1562
57 Ga0439449_0087288 3300042007 Bacteria 1151
58 Ga0439450_043049 3300042008 Bacteria 1054
59 Ga0439457_002567 3300042014 Bacteria 5147
60 Ga0439463_016431 3300042016 Bacteria 1830
61 Ga0451577_0387388 3300042876 Bacteria 1269
62 Ga0466966_0167282 3300044684 Bacteria 1337
63 Ga0466960_0150300 3300044901 Bacteria 1244
64 Ga0466959_0853773 3300045049 Bacteria 608
65 Ga0495603_0020671 3300046455 Bacteria 3987
66 Ga0495603_0056080 3300046455 Bacteria 2333
67 Ga0495650_0219329 3300046471 Bacteria 655
68 Ga0495605_0091844 3300046474 Bacteria 1406
69 Ga0495631_0248441 3300046518 Bacteria 758
70 Ga0495642_0216574 3300046528 Bacteria 836
71 Ga0495668_0685962 3300046616 Bacteria 566
72 Ga0495589_0009097 3300046794 Bacteria 5163
73 Ga0495589_0014733 3300046794 Bacteria 4023
74 Ga0495636_0187457 3300047318 Bacteria 941
75 Ga0495676_0014310 3300047321 Bacteria 7099
76 Ga0495676_0070225 3300047321 Bacteria 2698
77 Ga0495685_000922 3300047447 Bacteria 8910
78 Ga0495614_0261729 3300048089 Bacteria 793
79 Ga0496115_0196472 3300048918 Bacteria 1667
80 Ga0496118_0027053 3300048921 Bacteria 4864
81 Ga0496119_0037335 3300048922 Bacteria 3157
82 Ga0496120_0033275 3300048923 Bacteria 3098
83 Ga0496121_0001405 3300048924 Bacteria 40772
84 Ga0496123_0026547 3300048926 Bacteria 4334
85 Ga0496124_0157474 3300048927 Bacteria 1774
86 Ga0496125_0000146 3300048928 Bacteria 154919
87 Ga0496126_0019836 3300048929 Bacteria 6611
88 Ga0501034_0510414 3300049571 Bacteria 1115
89 Ga0501041_0403366 3300049577 Bacteria 866
90 Ga0501042_0404796 3300049578 Unclassified 989
91 Ga0501046_0029644 3300049580 Bacteria 4448
92 Ga0501076_0640243 3300049592 Bacteria 877
93 Ga0501083_1059962 3300049744 Bacteria 528
94 Ga0501035_0191315 3300049822 Bacteria 1759
95 Ga0501044_0179031 3300049823 Bacteria 2088
96 Ga0501044_0625053 3300049823 Bacteria 968
97 nmdc:mga03n38_4194_c1 3300050490 Bacteria 4742
98 nmdc:mga0yw44_9023_c1 3300050492 Bacteria 3807
99 nmdc:mga06r32_1361_c1 3300050510 Bacteria 22083
100 nmdc:mga08y16_1426756_c1 3300050511 Bacteria 655
101 Ga0500635_0000762 3300053080 Bacteria 8023
102 Ga0500559_0102434 3300053136 Bacteria 1320
103 Ga0500600_0383845 3300053149 Bacteria 564
104 2862293626 2862290372 Bacteria 7471434
105 2547408868 2547132111 Bacteria 8013147
106 2585305958 2582581313 Bacteria 10042643
107 2643875854 2643221572 Bacteria 3614809
108 2644382909 2643221669 Bacteria 3611286
109 2768643709 2767802112 Bacteria 6465194
110 2784586029 2784132148 Bacteria 8627943
111 2786667252 2786546132 Bacteria 10419719
112 2812361533 2811994879 Bacteria 9313447
113 2848554282 2848551377 Bacteria 3720646
114 2858950880 2858950400 Bacteria 6783797
115 2862282416 2862281513 Bacteria 9621493
116 2862581709 2862574272 Bacteria 10567477
117 2873319640 2873314349 Bacteria 8512634
118 2877684237 2877676314 Bacteria 9512378
119 2887445103 2887443736 Bacteria 4426037
120 2891560187 2891554331 Bacteria 8812224
121 2895436222 2895427314 Bacteria 13147766
122 2912726269 2912723979 Bacteria 8557534
123 2941485517
124 2946064630 2946064051 Bacteria 8957905
125 2954682340 2954673503 Bacteria 9685905
126 2954690584 2954682443 Bacteria 9862841
127 2954700411 2954691527 Bacteria 10720516
128 2954701816 2954701450 Bacteria 10834262
129 2954751628 2954749733 Bacteria 10366972
130 2954767085 2954759201 Bacteria 9358192
131 2990066068 2990059506 Bacteria 9321252
132 2990090491 2990088156 Bacteria 6657676
133 JGI25160J50197_1013541
134 JGI25160J50197_1018427
135 JGI25407J50210_10018351
136 Ga0070660_100480894
137 Ga0070661_100392991
138 Ga0070668_100176894
139 Ga0070675_100255511
140 Ga0070685_10129197
141 Ga0068852_100895650
142 Ga0081455_10216264
143 Ga0081538_10000202
144 Ga0081538_10001486
145 Ga0081538_10003252
146 Ga0081538_10014652
147 Ga0081538_10016620
148 Ga0081538_10017991
149 Ga0075363_100004714
150 Ga0075428_100770804
151 Ga0075431_100000633
152 Ga0111539_12048315
153 Ga0105242_10517260
154 Ga0157371_10180236
155 Ga0183367_1003
156 Ga0207426_1002106
157 Ga0207426_1026488
158 Ga0207657_10254615
159 Ga0207659_11022613
160 Ga0207668_10134919
161 Ga0207668_10515881
162 Ga0207640_10219658
163 Ga0207648_10091080
164 Ga0207698_10019132
165 Ga0307408_100926354
166 Ga0307508_10024108
167 Ga0307516_10193834
168 Ga0307405_10412592
169 Ga0307410_10095181
170 Ga0307412_10103173
171 Ga0307409_100028272
172 Ga0307409_101474906
173 Ga0307416_100148140
174 Ga0307416_100703339
175 Ga0307415_100011905
176 Ga0307415_100021029
177 Ga0307415_100179738
178 Ga0307415_100391412
179 Ga0439436_0022514
180 Ga0439439_0001850
181 Ga0451789_0055472
182 Ga0451791_1405267
183 Ga0451853_1072307
184 Ga0451853_3992282
185 Ga0439433_0000716
186 Ga0439442_022540
187 Ga0439448_0082051
188 Ga0439449_0049081
189 Ga0439449_0087288
190 Ga0439450_043049
191 Ga0439457_002567
192 Ga0439463_016431
193 Ga0451577_0387388
194 Ga0466966_0167282
195 Ga0466960_0150300
196 Ga0466959_0853773
197 Ga0495603_0020671
198 Ga0495603_0056080
199 Ga0495650_0219329
200 Ga0495605_0091844
201 Ga0495631_0248441
202 Ga0495642_0216574
203 Ga0495668_0685962
204 Ga0495589_0009097
205 Ga0495589_0014733
206 Ga0495636_0187457
207 Ga0495676_0014310
208 Ga0495676_0070225
209 Ga0495685_000922
210 Ga0495614_0261729
211 Ga0496115_0196472
212 Ga0496118_0027053
213 Ga0496119_0037335
214 Ga0496120_0033275
215 Ga0496121_0001405
216 Ga0496123_0026547
217 Ga0496124_0157474
218 Ga0496125_0000146
219 Ga0496126_0019836
220 Ga0501034_0510414
221 Ga0501041_0403366
222 Ga0501042_0404796
223 Ga0501046_0029644
224 Ga0501076_0640243
225 Ga0501083_1059962
226 Ga0501035_0191315
227 Ga0501044_0179031
228 Ga0501044_0625053
229 nmdc:mga03n38_4194_c1
230 nmdc:mga0yw44_9023_c1
231 nmdc:mga06r32_1361_c1
232 nmdc:mga08y16_1426756_c1
233 Ga0500635_0000762
234 Ga0500559_0102434
235 Ga0500600_0383845
236 2862293626
237 2547408868
238 2585305958
239 2643875854
240 2644382909
241 2768643709
242 2784586029
243 2786667252
244 2812361533
245 2848554282
246 2858950880
247 2862282416
248 2862581709
249 2873319640
250 2877684237
251 2887445103
252 2891560187
253 2895436222
254 2912726269
255 2941485517
256 2946064630
257 2954682340
258 2954690584
259 2954700411
260 2954701816
261 2954751628
262 2954767085
263 2990066068
264 2990090491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14437

MafB19-deam

MafB19-like deaminase

38

153

0.91

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

36

136

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkp-assembly1.cif.gz_B crystal structure of msmeg3575 in complex with 5-azacytosine 0.9854 2 153
5xkq-assembly2.cif.gz_D crystal structure of msmeg3575 in complex with ammeline 0.9848 1 153
5xko-assembly1.cif.gz_A crystal structure of native msmeg3575 deaminase from mycobacterium smegmatis 0.9844 1 152
5xkp-assembly2.cif.gz_C crystal structure of msmeg3575 in complex with 5-azacytosine 0.9826 2 153
5xkq-assembly2.cif.gz_C crystal structure of msmeg3575 in complex with ammeline 0.9823 2 152
ID Description Score Start End Superfamily
af_A0A1D6EFG6_210_277_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9509 76 105 3.40.140.10
4es9C02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8731 27 41 2.60.40.3580
af_O59834_3_162_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8692 1 157 3.40.140.10
af_A0A1D6ELV0_114_227_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8522 9 110 3.40.140.10
af_O59834_3_162_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8488 1 157 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2T4AXC6-F1-model_v4 Uncharacterized protein 0.9966 66 157 GO:0003824
GO:0006139
AF-A0A562C509-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9949 76 156 GO:0003824
AF-A0A1C6M2D4-F1-model_v4 Cytosine/adenosine deaminases 0.9922 67 158 GO:0003824
AF-A0A5B8C338-F1-model_v4 Nucleoside deaminase 0.9915 1 155 GO:0003824
AF-W5YXP0-F1-model_v4 Cytidine deaminase 0.9912 1 157 GO:0003824

Map