F153453

General Info

Members Datasets Scaffolds Average Seq Length
132 64 264 147

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0282592|Ga0373924_0282592_118_582
Length 154
Sequence MIEFVSHSPAETEALGEEWGRAAQSGLVIGLSGELGAGKTQLVKGVARGLGTPARVHSPTFGLVNIYAAGRLTLFHLDLYRLPENVNTEQIIAAGLEEYLNPAGVTVIEWADRWFGPVAGPGFKIQNRPARGRFVRIEIVGDNERRITYEDSGA

Samples

Sample ID Description Type Environment
1 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
27 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
28 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
29 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
30 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
31 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
32 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
33 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
37 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
38 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
41 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
47 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
53 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
54 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
55 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
59 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
60 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
61 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.24
Stem 0
Stem Tuber 0
Unclassified 36.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373924_0282592 3300035410 Unclassified 736
2 rootH1_10012340 3300003323 Bacteria 2061
3 Ga0070689_100212598 3300005340 Bacteria 1584
4 Ga0070669_101193485 3300005353 Bacteria 657
5 Ga0070688_100180465 3300005365 Unclassified 1464
6 Ga0070688_100642601 3300005365 Bacteria 816
7 Ga0070711_100043968 3300005439 Bacteria 3029
8 Ga0070705_100039822 3300005440 Bacteria 2669
9 Ga0070685_10061703 3300005466 Bacteria 2196
10 Ga0070707_101114732 3300005468 Bacteria 755
11 Ga0068855_100045510 3300005563 Bacteria 5191
12 Ga0068856_100000172 3300005614 Bacteria 67506
13 Ga0068856_100047413 3300005614 Unclassified 4232
14 Ga0068859_100113983 3300005617 Bacteria 2767
15 Ga0068863_101783726 3300005841 Unclassified 625
16 Ga0070712_100067863 3300006175 Bacteria 2539
17 Ga0097620_100113983 3300006931 Bacteria 2767
18 Ga0105248_10161943 3300009177 Bacteria 2523
19 Ga0105238_10585792 3300009551 Bacteria 1122
20 Ga0105238_10929521 3300009551 Unclassified 889
21 Ga0207685_10625132 3300025905 Bacteria 580
22 Ga0207705_10310828 3300025909 Bacteria 1210
23 Ga0207663_10037619 3300025916 Bacteria 2919
24 Ga0207694_10639047 3300025924 Unclassified 896
25 Ga0207670_10197949 3300025936 Bacteria 1525
26 Ga0207667_10337519 3300025949 Bacteria 1538
27 Ga0207702_10003113 3300026078 Bacteria 15370
28 Ga0207702_10074868 3300026078 Bacteria 2923
29 Ga0207674_10496134 3300026116 Bacteria 1180
30 Ga0265337_1000147 3300028556 Bacteria 35245
31 Ga0265337_1001122 3300028556 Bacteria 13688
32 Ga0265337_1015803 3300028556 Unclassified 2458
33 Ga0265337_1031761 3300028556 Unclassified 1565
34 Ga0265337_1057070 3300028556 Bacteria 1087
35 Ga0265326_10002883 3300028558 Bacteria 5740
36 Ga0265319_1000003 3300028563 Bacteria 340561
37 Ga0265319_1011820 3300028563 Bacteria 3555
38 Ga0265319_1070012 3300028563 Unclassified 1125
39 Ga0265334_10011312 3300028573 Bacteria 3759
40 Ga0265334_10022098 3300028573 Unclassified 2595
41 Ga0265334_10059488 3300028573 Bacteria 1444
42 Ga0265318_10032125 3300028577 Unclassified 2033
43 Ga0265323_10000971 3300028653 Bacteria 14988
44 Ga0265323_10017420 3300028653 Bacteria 2790
45 Ga0265323_10029705 3300028653 Bacteria 2043
46 Ga0265322_10065404 3300028654 Unclassified 1031
47 Ga0265336_10000289 3300028666 Bacteria 34559
48 Ga0265336_10025985 3300028666 Unclassified 1841
49 Ga0265338_10000050 3300028800 Bacteria 213659
50 Ga0265338_10000088 3300028800 Bacteria 174641
51 Ga0265338_10000279 3300028800 Bacteria 92884
52 Ga0265338_10000347 3300028800 Bacteria 84472
53 Ga0265338_10000399 3300028800 Bacteria 77917
54 Ga0265338_10001952 3300028800 Bacteria 32165
55 Ga0265338_10002179 3300028800 Bacteria 30072
56 Ga0265338_10006557 3300028800 Bacteria 14777
57 Ga0265338_10009741 3300028800 Bacteria 11400
58 Ga0265338_10010988 3300028800 Bacteria 10520
59 Ga0265338_10017319 3300028800 Bacteria 7775
60 Ga0265338_10032993 3300028800 Bacteria 5037
61 Ga0265338_10036010 3300028800 Bacteria 4745
62 Ga0265338_10045666 3300028800 Unclassified 4024
63 Ga0265338_10057025 3300028800 Bacteria 3459
64 Ga0265338_10142887 3300028800 Unclassified 1872
65 Ga0265338_10286020 3300028800 Unclassified 1203
66 Ga0265324_10002060 3300029957 Bacteria 10667
67 Ga0265324_10008182 3300029957 Bacteria 4176
68 Ga0265324_10009103 3300029957 Unclassified 3896
69 Ga0265324_10013727 3300029957 Unclassified 3014
70 Ga0265324_10097299 3300029957 Bacteria 1001
71 Ga0265324_10103031 3300029957 Bacteria 969
72 Ga0265324_10111307 3300029957 Bacteria 930
73 Ga0265324_10177622 3300029957 Unclassified 723
74 Ga0265330_10266482 3300031235 Bacteria 722
75 Ga0265320_10002931 3300031240 Bacteria 11690
76 Ga0265320_10008897 3300031240 Bacteria 6103
77 Ga0265320_10012332 3300031240 Bacteria 4983
78 Ga0265320_10012440 3300031240 Bacteria 4950
79 Ga0265320_10059392 3300031240 Bacteria 1829
80 Ga0265320_10152168 3300031240 Unclassified 1044
81 Ga0265320_10235648 3300031240 Unclassified 813
82 Ga0265320_10430281 3300031240 Unclassified 583
83 Ga0265325_10021083 3300031241 Unclassified 3585
84 Ga0265340_10000492 3300031247 Bacteria 21623
85 Ga0265340_10034232 3300031247 Unclassified 2527
86 Ga0265340_10164864 3300031247 Unclassified 1005
87 Ga0265339_10043001 3300031249 Unclassified 2500
88 Ga0265339_10050966 3300031249 Bacteria 2261
89 Ga0265331_10271035 3300031250 Unclassified 761
90 Ga0265316_10005606 3300031344 Bacteria 12163
91 Ga0265316_10021830 3300031344 Bacteria 5411
92 Ga0265316_10035012 3300031344 Bacteria 4075
93 Ga0265316_10046973 3300031344 Unclassified 3418
94 Ga0265316_10071105 3300031344 Bacteria 2682
95 Ga0265316_10106485 3300031344 Unclassified 2127
96 Ga0265316_10237801 3300031344 Unclassified 1340
97 Ga0265316_10411884 3300031344 Bacteria 973
98 Ga0265316_10513800 3300031344 Unclassified 855
99 Ga0265316_10730914 3300031344 Unclassified 697
100 Ga0265316_10816726 3300031344 Bacteria 653
101 Ga0265313_10013458 3300031595 Bacteria 4909
102 Ga0265314_10071152 3300031711 Unclassified 2329
103 Ga0265314_10102750 3300031711 Bacteria 1833
104 Ga0265314_10135574 3300031711 Bacteria 1529
105 Ga0265314_10173884 3300031711 Bacteria 1297
106 Ga0265342_10025575 3300031712 Unclassified 3709
107 Ga0265342_10088092 3300031712 Unclassified 1783
108 Ga0265342_10112833 3300031712 Bacteria 1537
109 Ga0265342_10118392 3300031712 Unclassified 1493
110 Ga0265342_10237781 3300031712 Unclassified 976
111 Ga0265342_10422904 3300031712 Bacteria 686
112 Ga0373956_0035638 3300035119 Unclassified 2195
113 Ga0373955_0423798 3300035172 Unclassified 810
114 Ga0373955_1008482 3300035172 Bacteria 513
115 Ga0373935_0363247 3300035692 Unclassified 1034
116 Ga0373927_0027377 3300035695 Bacteria 3722
117 Ga0373937_0306865 3300036401 Bacteria 1501
118 Ga0451576_0165049 3300045051 Bacteria 2311
119 Ga0451576_0324971 3300045051 Bacteria 1610
120 Ga0495592_0163058 3300046454 Bacteria 1532
121 Ga0495651_0264013 3300046462 Unclassified 1170
122 Ga0495662_0571056 3300046476 Unclassified 554
123 Ga0495664_0380382 3300046477 Unclassified 849
124 Ga0495652_0283584 3300046529 Bacteria 1212
125 Ga0495640_0415556 3300046533 Bacteria 825
126 Ga0495645_0452300 3300046543 Unclassified 810
127 Ga0495599_0082786 3300046678 Bacteria 2004
128 Ga0495674_0068194 3300047319 Bacteria 3079
129 Ga0495684_0187275 3300047471 Unclassified 1532
130 Ga0501047_0445777 3300049581 Unclassified 1124
131 Ga0501080_0074729 3300049742 Unclassified 3152
132 Ga0501035_0177755 3300049822 Unclassified 1835
133 Ga0373924_0282592
134 rootH1_10012340
135 Ga0070689_100212598
136 Ga0070669_101193485
137 Ga0070688_100180465
138 Ga0070688_100642601
139 Ga0070711_100043968
140 Ga0070705_100039822
141 Ga0070685_10061703
142 Ga0070707_101114732
143 Ga0068855_100045510
144 Ga0068856_100000172
145 Ga0068856_100047413
146 Ga0068859_100113983
147 Ga0068863_101783726
148 Ga0070712_100067863
149 Ga0097620_100113983
150 Ga0105248_10161943
151 Ga0105238_10585792
152 Ga0105238_10929521
153 Ga0207685_10625132
154 Ga0207705_10310828
155 Ga0207663_10037619
156 Ga0207694_10639047
157 Ga0207670_10197949
158 Ga0207667_10337519
159 Ga0207702_10003113
160 Ga0207702_10074868
161 Ga0207674_10496134
162 Ga0265337_1000147
163 Ga0265337_1001122
164 Ga0265337_1015803
165 Ga0265337_1031761
166 Ga0265337_1057070
167 Ga0265326_10002883
168 Ga0265319_1000003
169 Ga0265319_1011820
170 Ga0265319_1070012
171 Ga0265334_10011312
172 Ga0265334_10022098
173 Ga0265334_10059488
174 Ga0265318_10032125
175 Ga0265323_10000971
176 Ga0265323_10017420
177 Ga0265323_10029705
178 Ga0265322_10065404
179 Ga0265336_10000289
180 Ga0265336_10025985
181 Ga0265338_10000050
182 Ga0265338_10000088
183 Ga0265338_10000279
184 Ga0265338_10000347
185 Ga0265338_10000399
186 Ga0265338_10001952
187 Ga0265338_10002179
188 Ga0265338_10006557
189 Ga0265338_10009741
190 Ga0265338_10010988
191 Ga0265338_10017319
192 Ga0265338_10032993
193 Ga0265338_10036010
194 Ga0265338_10045666
195 Ga0265338_10057025
196 Ga0265338_10142887
197 Ga0265338_10286020
198 Ga0265324_10002060
199 Ga0265324_10008182
200 Ga0265324_10009103
201 Ga0265324_10013727
202 Ga0265324_10097299
203 Ga0265324_10103031
204 Ga0265324_10111307
205 Ga0265324_10177622
206 Ga0265330_10266482
207 Ga0265320_10002931
208 Ga0265320_10008897
209 Ga0265320_10012332
210 Ga0265320_10012440
211 Ga0265320_10059392
212 Ga0265320_10152168
213 Ga0265320_10235648
214 Ga0265320_10430281
215 Ga0265325_10021083
216 Ga0265340_10000492
217 Ga0265340_10034232
218 Ga0265340_10164864
219 Ga0265339_10043001
220 Ga0265339_10050966
221 Ga0265331_10271035
222 Ga0265316_10005606
223 Ga0265316_10021830
224 Ga0265316_10035012
225 Ga0265316_10046973
226 Ga0265316_10071105
227 Ga0265316_10106485
228 Ga0265316_10237801
229 Ga0265316_10411884
230 Ga0265316_10513800
231 Ga0265316_10730914
232 Ga0265316_10816726
233 Ga0265313_10013458
234 Ga0265314_10071152
235 Ga0265314_10102750
236 Ga0265314_10135574
237 Ga0265314_10173884
238 Ga0265342_10025575
239 Ga0265342_10088092
240 Ga0265342_10112833
241 Ga0265342_10118392
242 Ga0265342_10237781
243 Ga0265342_10422904
244 Ga0373956_0035638
245 Ga0373955_0423798
246 Ga0373955_1008482
247 Ga0373935_0363247
248 Ga0373927_0027377
249 Ga0373937_0306865
250 Ga0451576_0165049
251 Ga0451576_0324971
252 Ga0495592_0163058
253 Ga0495651_0264013
254 Ga0495662_0571056
255 Ga0495664_0380382
256 Ga0495652_0283584
257 Ga0495640_0415556
258 Ga0495645_0452300
259 Ga0495599_0082786
260 Ga0495674_0068194
261 Ga0495684_0187275
262 Ga0501047_0445777
263 Ga0501080_0074729
264 Ga0501035_0177755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

6

146

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.9022 2 142
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.9001 2 142
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.8833 2 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8704 2 138
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8492 2 142
ID Description Score Start End Superfamily
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8803 13 143 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8613 2 139 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8277 2 139 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8154 2 140 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8039 13 143 3.40.50.300
ID Description Score Start End GO Terms
AF-D8FEZ5-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9535 2 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A3A9ESR9-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9533 2 139 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A117KX23-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9529 1 139 GO:0002949
GO:0005524
GO:0005737
AF-A0A191HVT3-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9508 2 139 GO:0002949
GO:0005524
GO:0005737
AF-A0A3A9EFR3-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9507 1 114 GO:0002949
GO:0005524
GO:0005737
GO:0016740

Map