F151994

General Info

Members Datasets Scaffolds Average Seq Length
132 115 264 139

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_11015088|Ga0070685_110150881
Length 163
Sequence MESKIRYLVSVKHFRHRKGLVMAHEEKRAWIRLVVAILGYLAYVVIVAGRVDDRSLSDVPYASALLWTVGAAIVASIVAEIGMAIVTPGASRATDVRDREIGRLGDHVGQSFVIIGAVAAMLMAIADWDRFWIANVIYLCFVLSAILGGVTKVVVYRRSFPEW

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
47 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
48 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
51 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
52 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
53 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
54 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
55 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
56 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
57 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
62 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
68 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
84 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
87 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
88 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
89 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
90 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
91 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
92 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
93 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
94 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
95 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
96 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
97 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
99 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
100 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
101 2687453737 Frankia sp. BMG5.36 Isolate Nodule
102 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
103 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
104 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
105 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
106 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
107 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
108 2858868258 Micromonospora sp. MH33 Isolate Unclassified
109 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
110 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
111 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
112 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
113 2891562705 Microbispora tritici MT50 Isolate Unclassified
114 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
115 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0
Isolates 12.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.85
Nodule 2.27
Rhizoplane 7.58
Rhizosphere 62.88
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_11015088 3300005466 Bacteria 623
2 JGI25406J46586_10005271 3300003203 Bacteria 5999
3 Ga0070683_101554763 3300005329 Bacteria 636
4 Ga0070670_101983370 3300005331 Bacteria 536
5 Ga0070682_100198731 3300005337 Bacteria 1413
6 Ga0070689_100339319 3300005340 Bacteria 1258
7 Ga0070687_101338717 3300005343 Bacteria 533
8 Ga0070692_10856633 3300005345 Bacteria 625
9 Ga0070668_100001537 3300005347 Bacteria 16641
10 Ga0070668_100308425 3300005347 Bacteria 1329
11 Ga0070671_100299895 3300005355 Bacteria 1368
12 Ga0070671_100954326 3300005355 Bacteria 750
13 Ga0070688_100447219 3300005365 Bacteria 965
14 Ga0070714_100213318 3300005435 Bacteria 1770
15 Ga0070714_100915791 3300005435 Bacteria 851
16 Ga0070713_101367243 3300005436 Bacteria 686
17 Ga0070693_100288821 3300005547 Bacteria 1101
18 Ga0068862_100079586 3300005844 Bacteria 2841
19 Ga0068862_101121871 3300005844 Bacteria 782
20 Ga0081538_10010782 3300005981 Bacteria 7468
21 Ga0081538_10014870 3300005981 Bacteria 6064
22 Ga0081539_10007693 3300005985 Bacteria 9680
23 Ga0075365_10509317 3300006038 Bacteria 851
24 Ga0075364_10736385 3300006051 Bacteria 673
25 Ga0070716_100398974 3300006173 Bacteria 988
26 Ga0075367_10724636 3300006178 Bacteria 633
27 Ga0075428_102082375 3300006844 Bacteria 587
28 Ga0075435_100863444 3300007076 Bacteria 789
29 Ga0105246_12036140 3300011119 Bacteria 555
30 Ga0157369_10839774 3300013105 Bacteria 943
31 Ga0157375_10646286 3300013308 Bacteria 1214
32 Ga0163163_10291483 3300014325 Bacteria 1684
33 Ga0157379_10471815 3300014968 Bacteria 1161
34 Ga0207700_10118124 3300025928 Bacteria 2145
35 Ga0207664_10018340 3300025929 Bacteria 5149
36 Ga0207664_10057619 3300025929 Bacteria 3088
37 Ga0207644_10292285 3300025931 Bacteria 1311
38 Ga0207670_11471254 3300025936 Unclassified 579
39 Ga0207661_10925618 3300025944 Bacteria 803
40 Ga0207668_10002726 3300025972 Bacteria 10331
41 Ga0207675_100785154 3300026118 Bacteria 965
42 Ga0268265_10128320 3300028380 Bacteria 2103
43 Ga0268265_10814414 3300028380 Unclassified 911
44 Ga0307517_10525385 3300028786 Bacteria 597
45 Ga0307515_10267568 3300028794 Bacteria 1435
46 Ga0307515_10703718 3300028794 Bacteria 626
47 Ga0307512_10065896 3300030522 Bacteria 2740
48 Ga0307513_10338520 3300031456 Bacteria 1256
49 Ga0307508_10006260 3300031616 Bacteria 11216
50 Ga0307508_10264536 3300031616 Bacteria 1314
51 Ga0307413_10772502 3300031824 Bacteria 805
52 Ga0307410_11272215 3300031852 Bacteria 643
53 Ga0307416_100326028 3300032002 Bacteria 1541
54 Ga0307416_100851026 3300032002 Bacteria 1010
55 Ga0307416_100856180 3300032002 Bacteria 1007
56 Ga0307416_101036934 3300032002 Bacteria 924
57 Ga0307411_10399589 3300032005 Bacteria 1136
58 Ga0307415_100094738 3300032126 Bacteria 2172
59 Ga0307415_100135725 3300032126 Bacteria 1871
60 Ga0307415_100555454 3300032126 Bacteria 1014
61 Ga0307507_10158221 3300033179 Bacteria 1682
62 Ga0373935_0038438 3300035692 Bacteria 2997
63 Ga0395898_1500041 3300037466 Bacteria 600
64 Ga0451793_0385174 3300041452 Bacteria 816
65 Ga0451797_1389128 3300041453 Bacteria 896
66 Ga0451795_1011401 3300041456 Bacteria 865
67 Ga0451807_0844761 3300041486 Bacteria 777
68 Ga0451853_1677312 3300041512 Bacteria 742
69 Ga0439450_020045 3300042008 Bacteria 1423
70 Ga0439440_0003715 3300042993 Bacteria 2964
71 Ga0495590_0000142 3300046457 Bacteria 43345
72 Ga0495638_0161366 3300046460 Bacteria 1293
73 Ga0495632_0073382 3300046519 Bacteria 1641
74 Ga0495654_0124196 3300046530 Bacteria 1165
75 Ga0495625_0540979 3300046660 Bacteria 707
76 Ga0495672_0032541 3300047320 Bacteria 3242
77 Ga0496104_0864123 3300048907 Bacteria 810
78 Ga0496110_0657889 3300048913 Bacteria 948
79 Ga0496110_1259401 3300048913 Bacteria 649
80 Ga0496113_0819595 3300048916 Bacteria 739
81 Ga0496114_0000660 3300048917 Bacteria 25565
82 Ga0496115_0012959 3300048918 Bacteria 6289
83 Ga0496121_0550765 3300048924 Bacteria 722
84 Ga0501031_0083023 3300049568 Bacteria 2088
85 Ga0501036_0023881 3300049572 Bacteria 5153
86 Ga0501039_0434096 3300049575 Bacteria 1031
87 Ga0501040_0105283 3300049576 Bacteria 1970
88 Ga0501041_0033735 3300049577 Bacteria 3098
89 Ga0501042_0095725 3300049578 Bacteria 2133
90 Ga0501048_0030611 3300049582 Bacteria 3893
91 Ga0501067_0236819 3300049583 Bacteria 1016
92 Ga0501070_0387915 3300049586 Bacteria 1131
93 Ga0501071_0062677 3300049587 Bacteria 2694
94 Ga0501072_0079648 3300049588 Bacteria 2594
95 Ga0501072_0408326 3300049588 Bacteria 1077
96 Ga0501075_0080826 3300049591 Bacteria 2460
97 Ga0501076_0222781 3300049592 Bacteria 1541
98 Ga0501079_0139659 3300049741 Bacteria 1887
99 Ga0501079_0226637 3300049741 Bacteria 1460
100 Ga0501081_0082764 3300049743 Bacteria 2249
101 Ga0501045_0032290 3300049824 Bacteria 3794
102 nmdc:mga0yw44_1131977_c1 3300050492 Bacteria 528
103 nmdc:mga06z11_164961_c1 3300050494 Bacteria 1268
104 Ga0495655_0237744 3300053083 Bacteria 608
105 Ga0500646_0000088 3300053090 Bacteria 26075
106 Ga0500583_0006793 3300053092 Bacteria 3969
107 Ga0500641_0039429 3300053096 Bacteria 1903
108 Ga0500617_188586 3300053124 Bacteria 770
109 Ga0500652_092173 3300053131 Bacteria 1265
110 Ga0500568_0007771 3300053139 Bacteria 5227
111 Ga0500588_0008410 3300053146 Bacteria 2409
112 Ga0500633_0160787 3300053160 Bacteria 843
113 Ga0501084_0042531 3300054114 Bacteria 3801
114 Ga0501082_0231651 3300060353 Bacteria 1607
115 Ga0530510_0425587 3300061734 Bacteria 1002
116 2644505838 2643221690 Bacteria 4654705
117 2676205114 2675902999 Bacteria 9438463
118 2689957089 2687453737 Bacteria 11203906
119 2774849689 2773857921 Bacteria 9435764
120 2809591890 2808606522 Bacteria 9488490
121 2832009302 2832004796 Bacteria 6538017
122 2852643848 2852643534 Bacteria 3013378
123 2856747414 2856741275 Bacteria 8096094
124 2857737125 2857737099 Bacteria 3104305
125 2858872735 2858868258 Bacteria 7683772
126 2866066223 2866065130 Bacteria 6518152
127 2867508840 2867507094 Bacteria 6506033
128 2891399164 2891395885 Bacteria 9251614
129 2891555037 2891554331 Bacteria 8812224
130 2891565518 2891562705 Bacteria 8039471
131 2915775740 2915768154 Bacteria 8424322
132 8055178320 8055172936 Bacteria 9305943
133 Ga0070685_11015088
134 JGI25406J46586_10005271
135 Ga0070683_101554763
136 Ga0070670_101983370
137 Ga0070682_100198731
138 Ga0070689_100339319
139 Ga0070687_101338717
140 Ga0070692_10856633
141 Ga0070668_100001537
142 Ga0070668_100308425
143 Ga0070671_100299895
144 Ga0070671_100954326
145 Ga0070688_100447219
146 Ga0070714_100213318
147 Ga0070714_100915791
148 Ga0070713_101367243
149 Ga0070693_100288821
150 Ga0068862_100079586
151 Ga0068862_101121871
152 Ga0081538_10010782
153 Ga0081538_10014870
154 Ga0081539_10007693
155 Ga0075365_10509317
156 Ga0075364_10736385
157 Ga0070716_100398974
158 Ga0075367_10724636
159 Ga0075428_102082375
160 Ga0075435_100863444
161 Ga0105246_12036140
162 Ga0157369_10839774
163 Ga0157375_10646286
164 Ga0163163_10291483
165 Ga0157379_10471815
166 Ga0207700_10118124
167 Ga0207664_10018340
168 Ga0207664_10057619
169 Ga0207644_10292285
170 Ga0207670_11471254
171 Ga0207661_10925618
172 Ga0207668_10002726
173 Ga0207675_100785154
174 Ga0268265_10128320
175 Ga0268265_10814414
176 Ga0307517_10525385
177 Ga0307515_10267568
178 Ga0307515_10703718
179 Ga0307512_10065896
180 Ga0307513_10338520
181 Ga0307508_10006260
182 Ga0307508_10264536
183 Ga0307413_10772502
184 Ga0307410_11272215
185 Ga0307416_100326028
186 Ga0307416_100851026
187 Ga0307416_100856180
188 Ga0307416_101036934
189 Ga0307411_10399589
190 Ga0307415_100094738
191 Ga0307415_100135725
192 Ga0307415_100555454
193 Ga0307507_10158221
194 Ga0373935_0038438
195 Ga0395898_1500041
196 Ga0451793_0385174
197 Ga0451797_1389128
198 Ga0451795_1011401
199 Ga0451807_0844761
200 Ga0451853_1677312
201 Ga0439450_020045
202 Ga0439440_0003715
203 Ga0495590_0000142
204 Ga0495638_0161366
205 Ga0495632_0073382
206 Ga0495654_0124196
207 Ga0495625_0540979
208 Ga0495672_0032541
209 Ga0496104_0864123
210 Ga0496110_0657889
211 Ga0496110_1259401
212 Ga0496113_0819595
213 Ga0496114_0000660
214 Ga0496115_0012959
215 Ga0496121_0550765
216 Ga0501031_0083023
217 Ga0501036_0023881
218 Ga0501039_0434096
219 Ga0501040_0105283
220 Ga0501041_0033735
221 Ga0501042_0095725
222 Ga0501048_0030611
223 Ga0501067_0236819
224 Ga0501070_0387915
225 Ga0501071_0062677
226 Ga0501072_0079648
227 Ga0501072_0408326
228 Ga0501075_0080826
229 Ga0501076_0222781
230 Ga0501079_0139659
231 Ga0501079_0226637
232 Ga0501081_0082764
233 Ga0501045_0032290
234 nmdc:mga0yw44_1131977_c1
235 nmdc:mga06z11_164961_c1
236 Ga0495655_0237744
237 Ga0500646_0000088
238 Ga0500583_0006793
239 Ga0500641_0039429
240 Ga0500617_188586
241 Ga0500652_092173
242 Ga0500568_0007771
243 Ga0500588_0008410
244 Ga0500633_0160787
245 Ga0501084_0042531
246 Ga0501082_0231651
247 Ga0530510_0425587
248 2644505838
249 2676205114
250 2689957089
251 2774849689
252 2809591890
253 2832009302
254 2852643848
255 2856747414
256 2857737125
257 2858872735
258 2866066223
259 2867508840
260 2891399164
261 2891555037
262 2891565518
263 2915775740
264 8055178320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map