F151645

General Info

Members Datasets Scaffolds Average Seq Length
132 87 264 322

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10008650|Ga0070666_100086505
Length 356
Sequence MQNTIFQELASAAGKNQPVALAIISGVKGSSPQKVGAKAIFYSDGRIRGTMGGGCLEAEIQQRAIQSLRTGKAATFDLLLDHDFGWDDGLICGGKVFGVILPNAQSAGAEFWQELSERKTTLEWGVRTDFSIARVRDSDLATLPNKEATSLDGGWRYKEIVSPPCALWIAGAGHIAQAVAPLAQQLDFAVTVFDDRPALVNGQYFPGEVTLKADTWEKLLRLNLPETPSFGLIVTRGHRHDALVLKEWVHKPFLFLGMIGSSRKARTIFEHFREERFASEEELKRVACPVGIKIKSQSVMEISVSIMAQFIEKRAELVCVHGTQFQPYQSQELRVRLGRKLPGTSLMSLNKRATPL

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
77 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
86 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
87 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 3.03
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 23.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10008650 3300005335 Bacteria 6330
2 rootL2_10133786 3300003322 Bacteria 3428
3 Ga0070658_10114771 3300005327 Bacteria 2234
4 Ga0070683_100412856 3300005329 Unclassified 1287
5 Ga0070670_100203683 3300005331 Unclassified 1719
6 Ga0070680_100372880 3300005336 Unclassified 1214
7 Ga0070689_100004715 3300005340 Bacteria 9253
8 Ga0070687_100120497 3300005343 Bacteria 1500
9 Ga0070688_100017899 3300005365 Unclassified 4076
10 Ga0070708_100088146 3300005445 Unclassified 2821
11 Ga0070681_10148976 3300005458 Bacteria 2267
12 Ga0070679_100108832 3300005530 Unclassified 2758
13 Ga0070684_100142169 3300005535 Unclassified 2170
14 Ga0068853_100146257 3300005539 Unclassified 2124
15 Ga0070665_100000035 3300005548 Bacteria 315093
16 Ga0068855_100097531 3300005563 Bacteria 3386
17 Ga0068855_100170341 3300005563 Unclassified 2466
18 Ga0068856_100198453 3300005614 Unclassified 2021
19 Ga0068864_100038859 3300005618 Bacteria 4065
20 Ga0068863_100001013 3300005841 Bacteria 28120
21 Ga0068863_100033029 3300005841 Unclassified 4930
22 Ga0068858_100000744 3300005842 Bacteria 34152
23 Ga0068858_100022904 3300005842 Bacteria 5827
24 Ga0068858_100290120 3300005842 Unclassified 1559
25 Ga0081455_10052596 3300005937 Bacteria 3485
26 Ga0075429_100082857 3300006880 Unclassified 2796
27 Ga0105240_10009369 3300009093 Bacteria 13878
28 Ga0105240_10011257 3300009093 Bacteria 12471
29 Ga0105240_10158335 3300009093 Bacteria 2692
30 Ga0105245_10293489 3300009098 Bacteria 1593
31 Ga0105237_10088879 3300009545 Unclassified 3078
32 Ga0105238_10003091 3300009551 Bacteria 16591
33 Ga0105238_10259241 3300009551 Unclassified 1718
34 Ga0157370_10007219 3300013104 Bacteria 12126
35 Ga0157372_10496065 3300013307 Unclassified 1424
36 Ga0157375_10000116 3300013308 Bacteria 77874
37 Ga0157375_10265836 3300013308 Bacteria 1877
38 Ga0163163_10000064 3300014325 Bacteria 117551
39 Ga0163163_10039794 3300014325 Bacteria 4589
40 Ga0207707_10065021 3300025912 Bacteria 3177
41 Ga0207707_10142325 3300025912 Eukaryota 2097
42 Ga0207695_10015054 3300025913 Bacteria 9126
43 Ga0207695_10118216 3300025913 Unclassified 2622
44 Ga0207671_10050291 3300025914 Unclassified 3086
45 Ga0207694_10004385 3300025924 Bacteria 11021
46 Ga0207694_10146826 3300025924 Unclassified 1898
47 Ga0207664_10053302 3300025929 Bacteria 3201
48 Ga0207670_10002757 3300025936 Bacteria 9249
49 Ga0207661_10212986 3300025944 Unclassified 1704
50 Ga0207703_10002160 3300026035 Bacteria 17283
51 Ga0207703_10009372 3300026035 Bacteria 7694
52 Ga0207702_10091405 3300026078 Bacteria 2665
53 Ga0207641_10002278 3300026088 Bacteria 17896
54 Ga0207674_10004014 3300026116 Bacteria 17870
55 Ga0268266_10000044 3300028379 Bacteria 315137
56 Ga0265334_10012990 3300028573 Bacteria 3493
57 Ga0265338_10000138 3300028800 Bacteria 135457
58 Ga0265338_10000282 3300028800 Bacteria 91694
59 Ga0265338_10001340 3300028800 Bacteria 40157
60 Ga0265338_10015478 3300028800 Bacteria 8373
61 Ga0265338_10024483 3300028800 Bacteria 6166
62 Ga0265338_10106661 3300028800 Bacteria 2267
63 Ga0265338_10118705 3300028800 Bacteria 2113
64 Ga0265338_10156803 3300028800 Bacteria 1762
65 Ga0265338_10183890 3300028800 Unclassified 1591
66 Ga0265324_10000455 3300029957 Bacteria 28816
67 Ga0265324_10005931 3300029957 Bacteria 5183
68 Ga0307511_10000128 3300030521 Bacteria 69098
69 Ga0265339_10034349 3300031249 Bacteria 2850
70 Ga0265339_10096402 3300031249 Unclassified 1544
71 Ga0265331_10088345 3300031250 Bacteria 1434
72 Ga0265316_10065518 3300031344 Bacteria 2813
73 Ga0316575_10073533 3300031665 Bacteria 1375
74 Ga0373926_0005612 3300035083 Bacteria 4141
75 Ga0373926_0063464 3300035083 Bacteria 1349
76 Ga0373953_0098360 3300035117 Bacteria 1229
77 Ga0373954_0051931 3300035118 Bacteria 1926
78 Ga0373931_0026306 3300035691 Bacteria 2961
79 Ga0373931_0419913 3300035691 Unclassified 850
80 Ga0373927_0014746 3300035695 Bacteria 5168
81 Ga0373947_0045594 3300035725 Bacteria 2624
82 Ga0451807_2404885 3300041486 Bacteria 1852
83 Ga0453684_0263746 3300044712 Unclassified 1972
84 Ga0451576_0017726 3300045051 Bacteria 7825
85 Ga0451576_0028839 3300045051 Bacteria 5944
86 Ga0451576_0065994 3300045051 Bacteria 3768
87 Ga0451576_0093257 3300045051 Bacteria 3131
88 Ga0451576_0101978 3300045051 Bacteria 2985
89 Ga0451576_0102256 3300045051 Bacteria 2981
90 Ga0451576_0108404 3300045051 Bacteria 2890
91 Ga0451576_0197801 3300045051 Bacteria 2100
92 Ga0495592_0000087 3300046454 Bacteria 81851
93 Ga0495651_0172757 3300046462 Unclassified 1537
94 Ga0495608_0081606 3300046511 Bacteria 2101
95 Ga0495618_0001019 3300046514 Bacteria 19204
96 Ga0495628_0000056 3300046516 Bacteria 89432
97 Ga0495630_0000157 3300046517 Bacteria 52826
98 Ga0495630_0244333 3300046517 Bacteria 1371
99 Ga0495630_0267364 3300046517 Bacteria 1306
100 Ga0495666_0025186 3300046526 Bacteria 2939
101 Ga0495666_0030811 3300046526 Bacteria 2630
102 Ga0495652_0109027 3300046529 Bacteria 2230
103 Ga0495652_0123364 3300046529 Bacteria 2062
104 Ga0495640_0123952 3300046533 Bacteria 1677
105 Ga0495586_0000179 3300046535 Bacteria 42012
106 Ga0495586_0009174 3300046535 Bacteria 5265
107 Ga0495586_0100800 3300046535 Bacteria 1602
108 Ga0495586_0129009 3300046535 Bacteria 1415
109 Ga0495587_0064510 3300046536 Bacteria 2140
110 Ga0495645_0014499 3300046543 Bacteria 5594
111 Ga0495645_0044893 3300046543 Bacteria 3223
112 Ga0495645_0045710 3300046543 Unclassified 3195
113 Ga0495634_0009234 3300046642 Bacteria 7277
114 Ga0495599_0149796 3300046678 Unclassified 1445
115 Ga0495658_0067302 3300046683 Bacteria 2071
116 Ga0495658_0140170 3300046683 Bacteria 1478
117 Ga0495613_0052381 3300046689 Bacteria 3006
118 Ga0495613_0358643 3300046689 Unclassified 1000
119 Ga0495674_0014153 3300047319 Bacteria 7473
120 Ga0495674_0015467 3300047319 Bacteria 7129
121 Ga0495674_0338949 3300047319 Bacteria 1222
122 Ga0495676_0036641 3300047321 Bacteria 4094
123 Ga0495675_0047704 3300047444 Bacteria 2725
124 Ga0495684_0066748 3300047471 Bacteria 2735
125 Ga0496107_0024525 3300048910 Bacteria 4267
126 Ga0496115_0016400 3300048918 Bacteria 5641
127 nmdc:mga03683_143317_c1 3300050489 Unclassified 1075
128 nmdc:mga06r32_90068_c1 3300050510 Bacteria 2996
129 nmdc:mga0n895_176335_c1 3300050512 Bacteria 2168
130 Ga0495601_0070535 3300053077 Unclassified 2231
131 Ga0500645_023717 3300053730 Unclassified 1880
132 2787436910 2786546517 Bacteria 6614109
133 Ga0070666_10008650
134 rootL2_10133786
135 Ga0070658_10114771
136 Ga0070683_100412856
137 Ga0070670_100203683
138 Ga0070680_100372880
139 Ga0070689_100004715
140 Ga0070687_100120497
141 Ga0070688_100017899
142 Ga0070708_100088146
143 Ga0070681_10148976
144 Ga0070679_100108832
145 Ga0070684_100142169
146 Ga0068853_100146257
147 Ga0070665_100000035
148 Ga0068855_100097531
149 Ga0068855_100170341
150 Ga0068856_100198453
151 Ga0068864_100038859
152 Ga0068863_100001013
153 Ga0068863_100033029
154 Ga0068858_100000744
155 Ga0068858_100022904
156 Ga0068858_100290120
157 Ga0081455_10052596
158 Ga0075429_100082857
159 Ga0105240_10009369
160 Ga0105240_10011257
161 Ga0105240_10158335
162 Ga0105245_10293489
163 Ga0105237_10088879
164 Ga0105238_10003091
165 Ga0105238_10259241
166 Ga0157370_10007219
167 Ga0157372_10496065
168 Ga0157375_10000116
169 Ga0157375_10265836
170 Ga0163163_10000064
171 Ga0163163_10039794
172 Ga0207707_10065021
173 Ga0207707_10142325
174 Ga0207695_10015054
175 Ga0207695_10118216
176 Ga0207671_10050291
177 Ga0207694_10004385
178 Ga0207694_10146826
179 Ga0207664_10053302
180 Ga0207670_10002757
181 Ga0207661_10212986
182 Ga0207703_10002160
183 Ga0207703_10009372
184 Ga0207702_10091405
185 Ga0207641_10002278
186 Ga0207674_10004014
187 Ga0268266_10000044
188 Ga0265334_10012990
189 Ga0265338_10000138
190 Ga0265338_10000282
191 Ga0265338_10001340
192 Ga0265338_10015478
193 Ga0265338_10024483
194 Ga0265338_10106661
195 Ga0265338_10118705
196 Ga0265338_10156803
197 Ga0265338_10183890
198 Ga0265324_10000455
199 Ga0265324_10005931
200 Ga0307511_10000128
201 Ga0265339_10034349
202 Ga0265339_10096402
203 Ga0265331_10088345
204 Ga0265316_10065518
205 Ga0316575_10073533
206 Ga0373926_0005612
207 Ga0373926_0063464
208 Ga0373953_0098360
209 Ga0373954_0051931
210 Ga0373931_0026306
211 Ga0373931_0419913
212 Ga0373927_0014746
213 Ga0373947_0045594
214 Ga0451807_2404885
215 Ga0453684_0263746
216 Ga0451576_0017726
217 Ga0451576_0028839
218 Ga0451576_0065994
219 Ga0451576_0093257
220 Ga0451576_0101978
221 Ga0451576_0102256
222 Ga0451576_0108404
223 Ga0451576_0197801
224 Ga0495592_0000087
225 Ga0495651_0172757
226 Ga0495608_0081606
227 Ga0495618_0001019
228 Ga0495628_0000056
229 Ga0495630_0000157
230 Ga0495630_0244333
231 Ga0495630_0267364
232 Ga0495666_0025186
233 Ga0495666_0030811
234 Ga0495652_0109027
235 Ga0495652_0123364
236 Ga0495640_0123952
237 Ga0495586_0000179
238 Ga0495586_0009174
239 Ga0495586_0100800
240 Ga0495586_0129009
241 Ga0495587_0064510
242 Ga0495645_0014499
243 Ga0495645_0044893
244 Ga0495645_0045710
245 Ga0495634_0009234
246 Ga0495599_0149796
247 Ga0495658_0067302
248 Ga0495658_0140170
249 Ga0495613_0052381
250 Ga0495613_0358643
251 Ga0495674_0014153
252 Ga0495674_0015467
253 Ga0495674_0338949
254 Ga0495676_0036641
255 Ga0495675_0047704
256 Ga0495684_0066748
257 Ga0496107_0024525
258 Ga0496115_0016400
259 nmdc:mga03683_143317_c1
260 nmdc:mga06r32_90068_c1
261 nmdc:mga0n895_176335_c1
262 Ga0495601_0070535
263 Ga0500645_023717
264 2787436910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

167

310

0.97

PF02625

XdhC_CoxI

XdhC and CoxI family

12

79

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bay-assembly1.cif.gz_A phosphomimetic mutant of lsd1-8a splicing variant in complex with corest 0.9393 153 184
2z3y-assembly1.cif.gz_A crystal structure of lysine-specific demethylase1 0.9348 153 186
4czz-assembly1.cif.gz_A histone demethylase lsd1(kdm1a)-corest3 complex 0.9334 153 183
2dw4-assembly1.cif.gz_A crystal structure of human lsd1 at 2.3 a resolution 0.9333 153 184
7e0g-assembly1.cif.gz_A crystal structure of lysine specific demethylase 1 (lsd1) with tak-418, fad-adduct 0.9331 153 184
ID Description Score Start End Superfamily
4k7zA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9246 149 183 3.50.50.60
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9242 151 183 3.50.50.60
af_A0A1D6EF22_2_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9085 151 184 3.50.50.60
af_Q9EQ76_1_173_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9069 151 182 3.50.50.60
af_Q4DRR6_1_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.905 153 182 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V5N2C4-F1-model_v4 XdhC Rossmann domain-containing protein 0.951 192 306
AF-A0A7C6UAM1-F1-model_v4 XdhC/CoxF family protein 0.9483 151 304
AF-A0A3C1VGW2-F1-model_v4 XdhC/CoxI family protein 0.943 5 306
AF-A0A7C7L5X9-F1-model_v4 XdhC Rossmann domain-containing protein 0.936 146 304
AF-A0A3G5FLM1-F1-model_v4 XdhC Rossmann domain-containing protein 0.9334 158 304

Map