F149347

General Info

Members Datasets Scaffolds Average Seq Length
131 59 128 267

Family's Representative Sequence

Representative Sequence 3300025272|Ga0209455_1007555|Ga0209455_10075554
Length 290
Sequence LDYFAAYCPPLTHLLNYSFTVLYYDPIKRSLGNVFNRSPWLRRLFYHLLDLLLLRTWHVHRELRQWARGRTREPLQLLDAGAGYGQYSYWLSSLSSTWHILAVDVKDEQVKDSNDFFRAIGRPQVQFAVQDLVLYQEPNTFDLALSVDVMEHILEDVEVFRNIHTSLKDGGMLLISTPSDQGGSDVHDDSETSFIEEHVRDGYNIHEIQQKLRTAGFERIEAKYSYGEPGQISWRLSMKYPILLLGKSRWFFVLLPFYYLVVFPFCLLLNWLDARSTHDSGTGLIVKAWK

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
15 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
16 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
17 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
23 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
24 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
25 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
26 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
27 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
28 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
29 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
30 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
31 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
32 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
33 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
36 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
44 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
45 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
46 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
59 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 0
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100120713 3300005340 Unclassified 2093
2 Ga0070685_10003506 3300005466 Bacteria 7982
3 Ga0068852_100020909 3300005616 Bacteria 5211
4 Ga0068859_100723567 3300005617 Unclassified 1085
5 Ga0068860_100039464 3300005843 Bacteria 4516
6 Ga0070712_100130460 3300006175 Unclassified 1904
7 Ga0097620_100723420 3300006931 Unclassified 1085
8 Ga0105242_10105722 3300009176 Bacteria 2391
9 Ga0105242_10112085 3300009176 Bacteria 2327
10 Ga0157371_10050605 3300013102 Bacteria 2952
11 Ga0157375_10116170 3300013308 Bacteria 2780
12 Ga0163163_10059079 3300014325 Bacteria 3792
13 Ga0157380_10000003 3300014326 Bacteria 224643
14 Ga0157376_10154470 3300014969 Unclassified 2073
15 Ga0209455_1007555 3300025272 Bacteria 3054
16 Ga0207693_10149090 3300025915 Unclassified 1839
17 Ga0207686_10317348 3300025934 Bacteria 1163
18 Ga0207698_10115076 3300026142 Bacteria 2264
19 Ga0268264_10029147 3300028381 Bacteria 4520
20 Ga0265337_1026903 3300028556 Bacteria 1738
21 Ga0265338_10006195 3300028800 Bacteria 15333
22 Ga0265327_10002935 3300031251 Bacteria 17056
23 Ga0265327_10012745 3300031251 Bacteria 5644
24 Ga0265327_10033213 3300031251 Bacteria 2879
25 Ga0265316_10069846 3300031344 Bacteria 2710
26 Ga0265316_10100429 3300031344 Bacteria 2200
27 Ga0316579_10030888 3300031691 Bacteria 2450
28 Ga0265342_10170780 3300031712 Bacteria 1196
29 Ga0316576_10098313 3300031727 Bacteria 2185
30 Ga0316578_10012850 3300031728 Unclassified 4423
31 Ga0316578_10159044 3300031728 Unclassified 1361
32 Ga0316578_10203346 3300031728 Bacteria 1192
33 Ga0316577_10128438 3300031733 Unclassified 1426
34 Ga0316585_10052694 3300032137 Bacteria 1307
35 Ga0316580_10022904 3300032139 Bacteria 1928
36 Ga0316574_0054163 3300035398 Bacteria 2505
37 Ga0316574_0267789 3300035398 Unclassified 1090
38 Ga0373937_0272389 3300036401 Bacteria 1598
39 Ga0316582_0001632 3300036647 Bacteria 10015
40 Ga0316582_0078020 3300036647 Bacteria 2157
41 Ga0316584_0019230 3300036712 Unclassified 4936
42 Ga0316584_0081415 3300036712 Bacteria 2425
43 Ga0395899_0096835 3300037312 Bacteria 2134
44 Ga0395900_0016787 3300037418 Bacteria 7468
45 Ga0451577_0000037 3300042876 Bacteria 360162
46 Ga0451577_0000230 3300042876 Bacteria 113101
47 Ga0451577_0000548 3300042876 Bacteria 61415
48 Ga0451577_0005238 3300042876 Bacteria 13338
49 Ga0451577_0016530 3300042876 Bacteria 6831
50 Ga0451577_0017252 3300042876 Bacteria 6674
51 Ga0451577_0017579 3300042876 Bacteria 6606
52 Ga0451577_0028743 3300042876 Bacteria 5027
53 Ga0451577_0040917 3300042876 Bacteria 4161
54 Ga0451577_0057006 3300042876 Bacteria 3484
55 Ga0451577_0057409 3300042876 Bacteria 3470
56 Ga0451577_0088089 3300042876 Bacteria 2770
57 Ga0451577_0215692 3300042876 Bacteria 1734
58 Ga0451577_0541525 3300042876 Unclassified 1057
59 Ga0453683_0000021 3300044673 Bacteria 284502
60 Ga0453683_0000085 3300044673 Bacteria 140003
61 Ga0453683_0000092 3300044673 Bacteria 136648
62 Ga0453683_0000325 3300044673 Bacteria 58597
63 Ga0453683_0002954 3300044673 Bacteria 12776
64 Ga0453683_0005520 3300044673 Bacteria 8815
65 Ga0453683_0017896 3300044673 Bacteria 4554
66 Ga0453683_0031807 3300044673 Bacteria 3332
67 Ga0453683_0059725 3300044673 Bacteria 2384
68 Ga0453683_0063529 3300044673 Bacteria 2308
69 Ga0453683_0099135 3300044673 Bacteria 1829
70 Ga0453683_0109089 3300044673 Bacteria 1740
71 Ga0453683_0202815 3300044673 Bacteria 1259
72 Ga0453684_0000110 3300044712 Bacteria 360542
73 Ga0453684_0000337 3300044712 Bacteria 195296
74 Ga0453684_0000340 3300044712 Bacteria 194264
75 Ga0453684_0000497 3300044712 Bacteria 153728
76 Ga0453684_0000616 3300044712 Bacteria 130153
77 Ga0453684_0000759 3300044712 Bacteria 112043
78 Ga0453684_0000766 3300044712 Bacteria 111429
79 Ga0453684_0004644 3300044712 Bacteria 28544
80 Ga0453684_0007470 3300044712 Bacteria 20069
81 Ga0453684_0008327 3300044712 Bacteria 18650
82 Ga0453684_0008988 3300044712 Bacteria 17648
83 Ga0453684_0024748 3300044712 Bacteria 8752
84 Ga0453684_0029560 3300044712 Bacteria 7776
85 Ga0453684_0029756 3300044712 Bacteria 7740
86 Ga0453684_0057529 3300044712 Bacteria 5032
87 Ga0453684_0084741 3300044712 Unclassified 3940
88 Ga0453684_0094314 3300044712 Bacteria 3682
89 Ga0453684_0128962 3300044712 Bacteria 3038
90 Ga0453684_0153427 3300044712 Bacteria 2734
91 Ga0453684_0157676 3300044712 Bacteria 2689
92 Ga0453684_0191299 3300044712 Bacteria 2394
93 Ga0453684_0192585 3300044712 Bacteria 2384
94 Ga0453684_0402167 3300044712 Bacteria 1533
95 Ga0453684_0841233 3300044712 Unclassified 987
96 Ga0451576_0000039 3300045051 Bacteria 360162
97 Ga0451576_0000093 3300045051 Bacteria 226300
98 Ga0451576_0000264 3300045051 Bacteria 128283
99 Ga0451576_0000346 3300045051 Bacteria 112037
100 Ga0451576_0000639 3300045051 Bacteria 72715
101 Ga0451576_0000683 3300045051 Bacteria 69004
102 Ga0451576_0001907 3300045051 Bacteria 33418
103 Ga0451576_0004025 3300045051 Bacteria 19542
104 Ga0451576_0006480 3300045051 Bacteria 14344
105 Ga0451576_0032815 3300045051 Bacteria 5522
106 Ga0451576_0034410 3300045051 Bacteria 5381
107 Ga0451576_0087621 3300045051 Bacteria 3238
108 Ga0451576_0235178 3300045051 Bacteria 1913
109 Ga0451576_0267396 3300045051 Bacteria 1787
110 Ga0451576_0906616 3300045051 Bacteria 925
111 Ga0495652_0298908 3300046529 Bacteria 1171
112 Ga0495640_0094991 3300046533 Unclassified 1963
113 Ga0495680_0029014 3300047322 Bacteria 4534
114 Ga0501031_0000249 3300049568 Bacteria 30234
115 Ga0501032_0002030 3300049569 Bacteria 15972
116 Ga0501032_0141827 3300049569 Bacteria 1582
117 Ga0501033_0000004 3300049570 Bacteria 441310
118 Ga0501034_0001804 3300049571 Bacteria 27281
119 Ga0501036_0002845 3300049572 Bacteria 13717
120 Ga0501037_0049165 3300049573 Bacteria 3088
121 Ga0501038_0001517 3300049574 Bacteria 21376
122 Ga0501039_0001415 3300049575 Bacteria 17662
123 Ga0501043_0001976 3300049579 Bacteria 17491
124 Ga0501048_0053622 3300049582 Bacteria 2867
125 Ga0501035_0002702 3300049822 Bacteria 17241
126 Ga0501044_0002271 3300049823 Bacteria 21924
127 Ga0501045_0000002 3300049824 Bacteria 94022
128 Ga0500618_001800 3300053125 Bacteria 9033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0096835 Ga0395899_0096835_1454_2122 222
2 3300046533 Ga0495640_0094991 Ga0495640_0094991_74_763 229
3 3300045051 Ga0451576_0906616 Ga0451576_0906616_12_776 246
4 3300044712 Ga0453684_0192585 Ga0453684_0192585_1587_2339 249
5 3300009176 Ga0105242_10105722 Ga0105242_101057222 252
6 3300025934 Ga0207686_10317348 Ga0207686_103173481 252
7 3300044673 Ga0453683_0002954 Ga0453683_0002954_221_1042 252
8 3300044673 Ga0453683_0017896 Ga0453683_0017896_156_977 252
9 3300045051 Ga0451576_0001907 Ga0451576_0001907_24322_25143 252
10 3300005617 Ga0068859_100723567 Ga0068859_1007235672 255
11 3300006931 Ga0097620_100723420 Ga0097620_1007234202 255
12 3300031251 Ga0265327_10002935 Ga0265327_1000293510 255
13 3300031691 Ga0316579_10030888 Ga0316579_100308882 256
14 3300031728 Ga0316578_10159044 Ga0316578_101590442 256
15 3300031733 Ga0316577_10128438 Ga0316577_101284382 256
16 3300032137 Ga0316585_10052694 Ga0316585_100526941 256
17 3300035398 Ga0316574_0267789 Ga0316574_0267789_99_908 256
18 3300036647 Ga0316582_0078020 Ga0316582_0078020_914_1723 256
19 3300037418 Ga0395900_0016787 Ga0395900_0016787_1988_2794 256
20 3300044673 Ga0453683_0109089 Ga0453683_0109089_773_1582 257
21 3300028556 Ga0265337_1026903 Ga0265337_10269033 260
22 3300014969 Ga0157376_10154470 Ga0157376_101544702 261
23 iso_pu_bacteria 2739367866 2740032024 264
24 iso_pu_bacteria 2839989709 2839990623 264
25 iso_pu_bacteria 2910245624 2910250547 264
26 3300042876 Ga0451577_0000037 Ga0451577_0000037_300005_300826 265
27 3300042876 Ga0451577_0000548 Ga0451577_0000548_19116_19937 265
28 3300042876 Ga0451577_0017252 Ga0451577_0017252_3609_4430 265
29 3300042876 Ga0451577_0028743 Ga0451577_0028743_468_1289 265
30 3300042876 Ga0451577_0040917 Ga0451577_0040917_2304_3125 265
31 3300044673 Ga0453683_0000021 Ga0453683_0000021_154016_154837 265
32 3300044673 Ga0453683_0000085 Ga0453683_0000085_78229_79050 265
33 3300044673 Ga0453683_0202815 Ga0453683_0202815_77_898 265
34 3300044712 Ga0453684_0000110 Ga0453684_0000110_300385_301206 265
35 3300044712 Ga0453684_0000340 Ga0453684_0000340_28727_29548 265
36 3300044712 Ga0453684_0000616 Ga0453684_0000616_28432_29253 265
37 3300044712 Ga0453684_0000766 Ga0453684_0000766_19563_20384 265
38 3300044712 Ga0453684_0024748 Ga0453684_0024748_6738_7559 265
39 3300044712 Ga0453684_0094314 Ga0453684_0094314_1105_1926 265
40 3300045051 Ga0451576_0000039 Ga0451576_0000039_59337_60158 265
41 3300045051 Ga0451576_0000093 Ga0451576_0000093_164715_165536 265
42 3300045051 Ga0451576_0034410 Ga0451576_0034410_3742_4563 265
43 3300036401 Ga0373937_0272389 Ga0373937_0272389_602_1402 266
44 3300044712 Ga0453684_0000497 Ga0453684_0000497_23246_24070 266
45 3300044712 Ga0453684_0029756 Ga0453684_0029756_353_1165 266
46 3300044712 Ga0453684_0057529 Ga0453684_0057529_3268_4092 266
47 3300044712 Ga0453684_0402167 Ga0453684_0402167_353_1165 266
48 3300045051 Ga0451576_0000639 Ga0451576_0000639_70047_70859 266
49 3300045051 Ga0451576_0006480 Ga0451576_0006480_8058_8870 266
50 3300046529 Ga0495652_0298908 Ga0495652_0298908_92_892 266
51 3300047322 Ga0495680_0029014 Ga0495680_0029014_244_1044 266
52 3300006175 Ga0070712_100130460 Ga0070712_1001304601 267
53 3300025915 Ga0207693_10149090 Ga0207693_101490901 267
54 3300044673 Ga0453683_0099135 Ga0453683_0099135_430_1251 267
55 3300045051 Ga0451576_0004025 Ga0451576_0004025_15893_16708 267
56 3300005340 Ga0070689_100120713 Ga0070689_1001207132 268
57 3300005466 Ga0070685_10003506 Ga0070685_100035065 268
58 3300005616 Ga0068852_100020909 Ga0068852_1000209093 268
59 3300005843 Ga0068860_100039464 Ga0068860_1000394643 268
60 3300009176 Ga0105242_10112085 Ga0105242_101120852 268
61 3300013102 Ga0157371_10050605 Ga0157371_100506052 268
62 3300013308 Ga0157375_10116170 Ga0157375_101161703 268
63 3300014325 Ga0163163_10059079 Ga0163163_100590793 268
64 3300014326 Ga0157380_10000003 Ga0157380_10000003116 268
65 3300025272 Ga0209455_1007555 Ga0209455_10075554 268
66 3300026142 Ga0207698_10115076 Ga0207698_101150762 268
67 3300028381 Ga0268264_10029147 Ga0268264_100291473 268
68 3300028800 Ga0265338_10006195 Ga0265338_100061951 268
69 3300031251 Ga0265327_10012745 Ga0265327_100127457 268
70 3300031251 Ga0265327_10033213 Ga0265327_100332131 268
71 3300031344 Ga0265316_10069846 Ga0265316_100698463 268
72 3300031344 Ga0265316_10100429 Ga0265316_101004293 268
73 3300031712 Ga0265342_10170780 Ga0265342_101707802 268
74 3300031727 Ga0316576_10098313 Ga0316576_100983132 268
75 3300031728 Ga0316578_10012850 Ga0316578_100128505 268
76 3300031728 Ga0316578_10203346 Ga0316578_102033462 268
77 3300032139 Ga0316580_10022904 Ga0316580_100229042 268
78 3300035398 Ga0316574_0054163 Ga0316574_0054163_1670_2479 268
79 3300036647 Ga0316582_0001632 Ga0316582_0001632_5178_5987 268
80 3300036712 Ga0316584_0019230 Ga0316584_0019230_1068_1877 268
81 3300036712 Ga0316584_0081415 Ga0316584_0081415_460_1269 268
82 3300042876 Ga0451577_0000230 Ga0451577_0000230_50373_51194 268
83 3300042876 Ga0451577_0005238 Ga0451577_0005238_11917_12726 268
84 3300042876 Ga0451577_0016530 Ga0451577_0016530_2049_2861 268
85 3300042876 Ga0451577_0017579 Ga0451577_0017579_931_1752 268
86 3300042876 Ga0451577_0057006 Ga0451577_0057006_1208_2029 268
87 3300042876 Ga0451577_0057409 Ga0451577_0057409_2074_2889 268
88 3300042876 Ga0451577_0088089 Ga0451577_0088089_1696_2514 268
89 3300042876 Ga0451577_0215692 Ga0451577_0215692_350_1171 268
90 3300042876 Ga0451577_0541525 Ga0451577_0541525_141_950 268
91 3300044673 Ga0453683_0000092 Ga0453683_0000092_7172_7981 268
92 3300044673 Ga0453683_0000325 Ga0453683_0000325_17846_18667 268
93 3300044673 Ga0453683_0005520 Ga0453683_0005520_5076_5897 268
94 3300044673 Ga0453683_0031807 Ga0453683_0031807_16_837 268
95 3300044673 Ga0453683_0059725 Ga0453683_0059725_643_1461 268
96 3300044673 Ga0453683_0063529 Ga0453683_0063529_12_821 268
97 3300044712 Ga0453684_0000337 Ga0453684_0000337_49188_49997 268
98 3300044712 Ga0453684_0000759 Ga0453684_0000759_49315_50136 268
99 3300044712 Ga0453684_0004644 Ga0453684_0004644_24603_25412 268
100 3300044712 Ga0453684_0007470 Ga0453684_0007470_8439_9248 268
101 3300044712 Ga0453684_0008327 Ga0453684_0008327_13227_14039 268
102 3300044712 Ga0453684_0008988 Ga0453684_0008988_2335_3156 268
103 3300044712 Ga0453684_0029560 Ga0453684_0029560_1821_2636 268
104 3300044712 Ga0453684_0084741 Ga0453684_0084741_375_1184 268
105 3300044712 Ga0453684_0128962 Ga0453684_0128962_1523_2329 268
106 3300044712 Ga0453684_0153427 Ga0453684_0153427_1367_2188 268
107 3300044712 Ga0453684_0157676 Ga0453684_0157676_575_1387 268
108 3300044712 Ga0453684_0191299 Ga0453684_0191299_966_1775 268
109 3300044712 Ga0453684_0841233 Ga0453684_0841233_93_902 268
110 3300045051 Ga0451576_0000264 Ga0451576_0000264_2697_3509 268
111 3300045051 Ga0451576_0000346 Ga0451576_0000346_49322_50143 268
112 3300045051 Ga0451576_0000683 Ga0451576_0000683_13616_14425 268
113 3300045051 Ga0451576_0032815 Ga0451576_0032815_2210_3019 268
114 3300045051 Ga0451576_0087621 Ga0451576_0087621_2123_2932 268
115 3300045051 Ga0451576_0235178 Ga0451576_0235178_350_1171 268
116 3300045051 Ga0451576_0267396 Ga0451576_0267396_824_1645 268
117 3300049568 Ga0501031_0000249 Ga0501031_0000249_12857_13666 268
118 3300049569 Ga0501032_0002030 Ga0501032_0002030_12764_13573 268
119 3300049569 Ga0501032_0141827 Ga0501032_0141827_697_1506 268
120 3300049570 Ga0501033_0000004 Ga0501033_0000004_279308_280117 268
121 3300049571 Ga0501034_0001804 Ga0501034_0001804_14586_15395 268
122 3300049572 Ga0501036_0002845 Ga0501036_0002845_11982_12791 268
123 3300049573 Ga0501037_0049165 Ga0501037_0049165_1226_2035 268
124 3300049574 Ga0501038_0001517 Ga0501038_0001517_9313_10122 268
125 3300049575 Ga0501039_0001415 Ga0501039_0001415_16250_17059 268
126 3300049579 Ga0501043_0001976 Ga0501043_0001976_16151_16960 268
127 3300049582 Ga0501048_0053622 Ga0501048_0053622_1558_2367 268
128 3300049822 Ga0501035_0002702 Ga0501035_0002702_6000_6809 268
129 3300049823 Ga0501044_0002271 Ga0501044_0002271_7649_8458 268
130 3300049824 Ga0501045_0000002 Ga0501045_0000002_16488_17297 268
131 3300053125 Ga0500618_001800 Ga0500618_001800_4780_5652 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

77

171

0.91

PF08241

Methyltransf_11

Methyltransferase domain

78

175

0.91

PF08242

Methyltransf_12

Methyltransferase domain

78

173

0.87

PF13847

Methyltransf_31

Methyltransferase domain

72

220

0.84

PF13489

Methyltransf_23

Methyltransferase domain

47

222

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.9108 53 160
7phf-assembly2.cif.gz_C chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8892 53 154
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8685 52 202
8d58-assembly1.cif.gz_A crystal structure of human mettl1-wdr4 complex 0.8663 52 155
7phf-assembly2.cif.gz_D chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8538 53 160
ID Description Score Start End Superfamily
af_A0A1D6I0D9_80_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8889 52 153 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8832 41 153 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8803 54 111 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.873 50 109 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.869 52 155 3.40.50.150
ID Description Score Start End GO Terms
AF-B9TMB8-F1-model_v4 Methyltransferase 0.9192 51 151 GO:0008168
AF-A0A6N9NDM7-F1-model_v4 Methyltransferase domain-containing protein 0.9184 1 268 GO:0008168
GO:0016020
GO:0032259
AF-A0A6N9NDM7-F1-model_v4 Methyltransferase domain-containing protein 0.9151 1 268 GO:0008168
GO:0016020
GO:0032259
AF-A0A5L4KDC5-F1-model_v4 Class I SAM-dependent methyltransferase 0.903 49 143 GO:0008168
GO:0032259
AF-A0A1W7R8X4-F1-model_v4 Putative glutathione s-transferase inal domain-containing protein 0.9028 46 122 GO:0005737
GO:0016740

Feature Viewer

pLDDT pTM Quality
88.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map