F146495

General Info

Members Datasets Scaffolds Average Seq Length
130 59 260 188

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0084111|Ga0466963_0084111_669_1262
Length 197
Sequence VSADRGPGSAQTGSRGILLARHGETDDNIEPIRAQGWRDTRLNETGRAQAAGLAERIAERGEPIRSLWSSDLSRARETAEIVGQRIAMTPRLDRRLREGWRGRWEGRLFIDIAREEPDLYAAWMRGGAGWRFPDGESLLEHQQRVAACIDDIEGTGELPALVVCHGGSIRVMLCLSDPRGLDAFHTFAIPNVSVVEL

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
17 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
19 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
33 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
36 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
42 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
43 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
44 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
49 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
52 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
58 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
59 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.08
Rhizosphere 55.38
Stem 0
Stem Tuber 0
Unclassified 10.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0084111 3300044694 Unclassified 2158
2 Ga0070683_100592475 3300005329 Unclassified 1061
3 Ga0070690_100534004 3300005330 Bacteria 882
4 Ga0070671_100847959 3300005355 Bacteria 797
5 Ga0070713_100262177 3300005436 Bacteria 1580
6 Ga0070710_10259942 3300005437 Bacteria 1119
7 Ga0070711_100303164 3300005439 Bacteria 1271
8 Ga0070684_100141110 3300005535 Bacteria 2179
9 Ga0068857_100608612 3300005577 Bacteria 1033
10 Ga0068854_100663064 3300005578 Unclassified 897
11 Ga0070717_10227307 3300006028 Bacteria 1642
12 Ga0070712_100356301 3300006175 Bacteria 1199
13 Ga0105240_10078501 3300009093 Bacteria 4065
14 Ga0105249_10113921 3300009553 Bacteria 2560
15 Ga0105239_10388383 3300010375 Bacteria 1579
16 Ga0157372_10385180 3300013307 Bacteria 1634
17 Ga0206353_11303849 3300020082 Bacteria 2496
18 Ga0213873_10086427 3300021358 Bacteria 885
19 Ga0213874_10000103 3300021377 Bacteria 13733
20 Ga0213876_10004008 3300021384 Bacteria 8293
21 Ga0213876_10016578 3300021384 Unclassified 3894
22 Ga0213876_10034408 3300021384 Bacteria 2671
23 Ga0213876_10042051 3300021384 Bacteria 2415
24 Ga0213875_10000693 3300021388 Bacteria 26070
25 Ga0213875_10006300 3300021388 Bacteria 6246
26 Ga0213875_10090234 3300021388 Bacteria 1429
27 Ga0213875_10121714 3300021388 Bacteria 1219
28 Ga0213875_10147324 3300021388 Bacteria 1103
29 Ga0207688_10051277 3300025901 Bacteria 2311
30 Ga0207693_10127826 3300025915 Bacteria 1998
31 Ga0207687_10288108 3300025927 Bacteria 1319
32 Ga0207700_10193405 3300025928 Bacteria 1711
33 Ga0207664_10044581 3300025929 Bacteria 3474
34 Ga0207664_10142670 3300025929 Bacteria 2028
35 Ga0207664_10416941 3300025929 Bacteria 1196
36 Ga0207661_10997135 3300025944 Unclassified 771
37 Ga0207640_11082218 3300025981 Bacteria 708
38 Ga0207674_10607041 3300026116 Bacteria 1057
39 Ga0265326_10094243 3300028558 Bacteria 848
40 Ga0265338_10346490 3300028800 Bacteria 1069
41 Ga0373937_1169909 3300036401 Bacteria 718
42 Ga0436364_0059823 3300037853 Bacteria 1712
43 Ga0436364_0090407 3300037853 Bacteria 1254
44 Ga0436364_0095071 3300037853 Bacteria 881
45 Ga0436364_0182517 3300037853 Unclassified 695
46 Ga0436364_0312041 3300037853 Bacteria 14073
47 Ga0436364_0649538 3300037853 Unclassified 1645
48 Ga0436364_0657384 3300037853 Bacteria 6943
49 Ga0436364_0720345 3300037853 Bacteria 21919
50 Ga0436364_0852360 3300037853 Bacteria 12919
51 Ga0436364_1020611 3300037853 Bacteria 1426
52 Ga0436364_1156440 3300037853 Bacteria 43375
53 Ga0436364_1238447 3300037853 Bacteria 2459
54 Ga0436365_0219407 3300039437 Bacteria 734
55 Ga0436365_0234000 3300039437 Bacteria 7434
56 Ga0436365_0262066 3300039437 Bacteria 1210
57 Ga0436365_0289606 3300039437 Bacteria 3011
58 Ga0436365_0335012 3300039437 Bacteria 3953
59 Ga0436365_0410975 3300039437 Bacteria 13005
60 Ga0436365_0429262 3300039437 Bacteria 1248
61 Ga0436365_0618097 3300039437 Bacteria 5504
62 Ga0436365_0973680 3300039437 Bacteria 11983
63 Ga0436365_0979217 3300039437 Bacteria 30500
64 Ga0436365_1173358 3300039437 Bacteria 13544
65 Ga0436365_1371915 3300039437 Bacteria 5664
66 Ga0436365_1771030 3300039437 Bacteria 5165
67 Ga0436363_0073223 3300039450 Bacteria 3458
68 Ga0436363_0132492 3300039450 Bacteria 4393
69 Ga0436363_0248018 3300039450 Unclassified 2580
70 Ga0436363_0493150 3300039450 Bacteria 818
71 Ga0436363_0655382 3300039450 Bacteria 2065
72 Ga0436363_1045753 3300039450 Bacteria 64108
73 Ga0436362_0428401 3300039453 Bacteria 1535
74 Ga0436362_0568081 3300039453 Bacteria 2834
75 Ga0436362_0715502 3300039453 Bacteria 2334
76 Ga0436362_0832323 3300039453 Bacteria 4041
77 Ga0436362_1260368 3300039453 Bacteria 1535
78 Ga0436362_1287125 3300039453 Bacteria 1026
79 Ga0466965_0155858 3300044683 Bacteria 1196
80 Ga0466965_0368848 3300044683 Unclassified 789
81 Ga0466966_0144723 3300044684 Bacteria 1451
82 Ga0466961_0012909 3300044693 Bacteria 5344
83 Ga0466963_0004338 3300044694 Bacteria 8233
84 Ga0466963_0015317 3300044694 Bacteria 4744
85 Ga0466963_0057112 3300044694 Bacteria 2599
86 Ga0466963_0879699 3300044694 Bacteria 631
87 Ga0466971_0218341 3300044719 Bacteria 903
88 Ga0466968_0010338 3300044735 Unclassified 3615
89 Ga0466968_0011267 3300044735 Bacteria 3481
90 Ga0466968_0028619 3300044735 Bacteria 2299
91 Ga0466968_0056010 3300044735 Bacteria 1693
92 Ga0466968_0128419 3300044735 Bacteria 1152
93 Ga0466968_0238064 3300044735 Bacteria 861
94 Ga0466970_0062515 3300044765 Bacteria 1996
95 Ga0466970_0130833 3300044765 Unclassified 1378
96 Ga0466957_0420174 3300044842 Bacteria 917
97 Ga0466960_0143988 3300044901 Bacteria 1268
98 Ga0466959_0004073 3300045049 Bacteria 9726
99 Ga0466959_0036685 3300045049 Bacteria 3622
100 Ga0466959_0120346 3300045049 Bacteria 1867
101 Ga0466959_0131716 3300045049 Bacteria 1772
102 Ga0466959_0437007 3300045049 Bacteria 888
103 Ga0466958_0010804 3300045836 Bacteria 5125
104 Ga0466958_0021778 3300045836 Bacteria 3749
105 Ga0466958_0059329 3300045836 Bacteria 2327
106 Ga0466958_0085852 3300045836 Bacteria 1942
107 Ga0466958_0165211 3300045836 Unclassified 1400
108 Ga0466958_0180637 3300045836 Bacteria 1339
109 Ga0466967_0235687 3300045976 Unclassified 1744
110 Ga0466967_0279021 3300045976 Bacteria 1603
111 Ga0495623_0377662 3300046679 Archaea 767
112 Ga0495684_0010650 3300047471 Bacteria 7107
113 Ga0496102_0771363 3300048905 Bacteria 884
114 Ga0496103_0089638 3300048906 Bacteria 1940
115 Ga0496103_0161483 3300048906 Bacteria 1437
116 Ga0496104_0122662 3300048907 Bacteria 2495
117 Ga0496104_0908694 3300048907 Bacteria 785
118 Ga0496105_0193722 3300048908 Bacteria 1661
119 Ga0496105_0337524 3300048908 Bacteria 1205
120 Ga0496105_0656725 3300048908 Unclassified 809
121 Ga0496107_0057063 3300048910 Bacteria 2822
122 Ga0496111_0017364 3300048914 Bacteria 4976
123 Ga0496111_0097406 3300048914 Bacteria 2159
124 Ga0496111_0794674 3300048914 Bacteria 685
125 Ga0496113_0063172 3300048916 Bacteria 2798
126 Ga0496114_0234739 3300048917 Bacteria 1612
127 Ga0496115_0000101 3300048918 Bacteria 80831
128 Ga0496115_0120038 3300048918 Bacteria 2163
129 Ga0496115_0472624 3300048918 Bacteria 1010
130 Ga0466962_0013787 3300061719 Bacteria 3891
131 Ga0466963_0084111
132 Ga0070683_100592475
133 Ga0070690_100534004
134 Ga0070671_100847959
135 Ga0070713_100262177
136 Ga0070710_10259942
137 Ga0070711_100303164
138 Ga0070684_100141110
139 Ga0068857_100608612
140 Ga0068854_100663064
141 Ga0070717_10227307
142 Ga0070712_100356301
143 Ga0105240_10078501
144 Ga0105249_10113921
145 Ga0105239_10388383
146 Ga0157372_10385180
147 Ga0206353_11303849
148 Ga0213873_10086427
149 Ga0213874_10000103
150 Ga0213876_10004008
151 Ga0213876_10016578
152 Ga0213876_10034408
153 Ga0213876_10042051
154 Ga0213875_10000693
155 Ga0213875_10006300
156 Ga0213875_10090234
157 Ga0213875_10121714
158 Ga0213875_10147324
159 Ga0207688_10051277
160 Ga0207693_10127826
161 Ga0207687_10288108
162 Ga0207700_10193405
163 Ga0207664_10044581
164 Ga0207664_10142670
165 Ga0207664_10416941
166 Ga0207661_10997135
167 Ga0207640_11082218
168 Ga0207674_10607041
169 Ga0265326_10094243
170 Ga0265338_10346490
171 Ga0373937_1169909
172 Ga0436364_0059823
173 Ga0436364_0090407
174 Ga0436364_0095071
175 Ga0436364_0182517
176 Ga0436364_0312041
177 Ga0436364_0649538
178 Ga0436364_0657384
179 Ga0436364_0720345
180 Ga0436364_0852360
181 Ga0436364_1020611
182 Ga0436364_1156440
183 Ga0436364_1238447
184 Ga0436365_0219407
185 Ga0436365_0234000
186 Ga0436365_0262066
187 Ga0436365_0289606
188 Ga0436365_0335012
189 Ga0436365_0410975
190 Ga0436365_0429262
191 Ga0436365_0618097
192 Ga0436365_0973680
193 Ga0436365_0979217
194 Ga0436365_1173358
195 Ga0436365_1371915
196 Ga0436365_1771030
197 Ga0436363_0073223
198 Ga0436363_0132492
199 Ga0436363_0248018
200 Ga0436363_0493150
201 Ga0436363_0655382
202 Ga0436363_1045753
203 Ga0436362_0428401
204 Ga0436362_0568081
205 Ga0436362_0715502
206 Ga0436362_0832323
207 Ga0436362_1260368
208 Ga0436362_1287125
209 Ga0466965_0155858
210 Ga0466965_0368848
211 Ga0466966_0144723
212 Ga0466961_0012909
213 Ga0466963_0004338
214 Ga0466963_0015317
215 Ga0466963_0057112
216 Ga0466963_0879699
217 Ga0466971_0218341
218 Ga0466968_0010338
219 Ga0466968_0011267
220 Ga0466968_0028619
221 Ga0466968_0056010
222 Ga0466968_0128419
223 Ga0466968_0238064
224 Ga0466970_0062515
225 Ga0466970_0130833
226 Ga0466957_0420174
227 Ga0466960_0143988
228 Ga0466959_0004073
229 Ga0466959_0036685
230 Ga0466959_0120346
231 Ga0466959_0131716
232 Ga0466959_0437007
233 Ga0466958_0010804
234 Ga0466958_0021778
235 Ga0466958_0059329
236 Ga0466958_0085852
237 Ga0466958_0165211
238 Ga0466958_0180637
239 Ga0466967_0235687
240 Ga0466967_0279021
241 Ga0495623_0377662
242 Ga0495684_0010650
243 Ga0496102_0771363
244 Ga0496103_0089638
245 Ga0496103_0161483
246 Ga0496104_0122662
247 Ga0496104_0908694
248 Ga0496105_0193722
249 Ga0496105_0337524
250 Ga0496105_0656725
251 Ga0496107_0057063
252 Ga0496111_0017364
253 Ga0496111_0097406
254 Ga0496111_0794674
255 Ga0496113_0063172
256 Ga0496114_0234739
257 Ga0496115_0000101
258 Ga0496115_0120038
259 Ga0496115_0472624
260 Ga0466962_0013787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

17

197

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9178 2 196
1c7z-assembly1.cif.gz_B regulatory complex of fructose-2,6-bisphosphatase 0.8964 2 193
3qpu-assembly1.cif.gz_A-2 pfkfb3 in complex with ppi 0.8953 2 193
6iby-assembly1.cif.gz_A human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 0.8944 2 193
4d4k-assembly1.cif.gz_A human pfkfb3 in complex with a pyrrolopyrimidone compound 0.8936 2 193
ID Description Score Start End Superfamily
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9429 2 196 3.40.50.1240
af_O06240_1_204_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9222 2 196 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9178 2 196 3.40.50.1240
af_Q5ABB4_12_212_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9121 2 180 3.40.50.1240
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9045 2 196 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A538EBZ8-F1-model_v4 Histidine phosphatase family protein 0.9714 2 199 GO:0005737
GO:0016791
AF-A0A532U4R6-F1-model_v4 Histidine phosphatase family protein 0.9651 2 196 GO:0005737
GO:0016791
AF-A0A1M5AM10-F1-model_v4 Probable phosphoglycerate mutase 0.9627 2 196 GO:0005737
GO:0016791
AF-A0A7V2MUV4-F1-model_v4 Histidine phosphatase family protein 0.961 2 196 GO:0005737
GO:0016791
AF-A0A075K1M1-F1-model_v4 Phosphoglycerate mutase 0.9601 2 196 GO:0016791

Map