F145835

General Info

Members Datasets Scaffolds Average Seq Length
130 106 260 305

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10492116|Ga0207674_104921161
Length 347
Sequence MDAVGHRARRDGIDEPDLSHLHYGQGVHGRAPLLLVDSASLYFRAYFGIPESAARAPDGRPVNAVRGFLDMVATLVRTRRPDRIVCALDEDWRPAWRVALIPSYKTHRLAVAGGDLNPDGGFNPGPDIEVVPDALEAQVPIILDVLAAFGIATAGAADYEADDIIGTLATREPGPIEVATGDRDLFQVVDDDRDVRVLYCGRGLAKLEVLDDAAIHTKYGVSAAGYADFAAMRGDPSDGLPXXXXVGEKTAARLIDRYGSLDGILAALDDPAAGFAPGLRNKLKAARDYLAVAPTVVRVAREIKLPHLDTALPAAPRSPERVAELAEAWNLSGAVRRLTEALTTAAS

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
45 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
46 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
47 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
48 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
49 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
50 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
51 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
52 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
53 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
54 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
55 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
56 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
57 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
61 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
66 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
94 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
95 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
96 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
101 2558860280 Kutzneria sp. 744 Isolate Unclassified
102 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
103 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
104 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
105 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
106 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 8.46
Rhizosphere 83.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10492116 3300026116 Bacteria 1185
2 JGI24739J22299_10005453 3300001989 Bacteria 4829
3 JGI24737J22298_10005325 3300001990 Bacteria 4450
4 JGI25406J46586_10036026 3300003203 Bacteria 1800
5 JGI25407J50210_10006271 3300003373 Bacteria 2955
6 Ga0070683_100001611 3300005329 Bacteria 17468
7 Ga0070660_100326111 3300005339 Bacteria 1262
8 Ga0070714_100010393 3300005435 Bacteria 7358
9 Ga0070662_100343176 3300005457 Bacteria 1222
10 Ga0070698_100001860 3300005471 Bacteria 23516
11 Ga0070679_100044148 3300005530 Bacteria 4441
12 Ga0070679_100166030 3300005530 Bacteria 2181
13 Ga0070684_100008493 3300005535 Bacteria 8032
14 Ga0070696_100006006 3300005546 Bacteria 8104
15 Ga0068857_100065529 3300005577 Bacteria 3230
16 Ga0068854_100296203 3300005578 Bacteria 1307
17 Ga0068856_100188071 3300005614 Bacteria 2079
18 Ga0068864_100057916 3300005618 Bacteria 3348
19 Ga0081455_10002081 3300005937 Bacteria 23862
20 Ga0081455_10125648 3300005937 Bacteria 2013
21 Ga0081538_10000388 3300005981 Bacteria 49943
22 Ga0081538_10026398 3300005981 Bacteria 4063
23 Ga0081539_10040876 3300005985 Bacteria 2718
24 Ga0075428_100000550 3300006844 Bacteria 38346
25 Ga0075428_100209193 3300006844 Bacteria 2108
26 Ga0075430_100000609 3300006846 Bacteria 27302
27 Ga0075430_100008453 3300006846 Bacteria 8697
28 Ga0075430_100051649 3300006846 Bacteria 3464
29 Ga0075431_100017641 3300006847 Bacteria 7257
30 Ga0075431_100081865 3300006847 Bacteria 3333
31 Ga0075431_100110144 3300006847 Bacteria 2842
32 Ga0075431_100642732 3300006847 Bacteria 1042
33 Ga0075433_10025762 3300006852 Bacteria 4973
34 Ga0075434_100045816 3300006871 Bacteria 4339
35 Ga0075429_100003881 3300006880 Bacteria 12772
36 Ga0075429_100139806 3300006880 Bacteria 2119
37 Ga0111539_10138934 3300009094 Bacteria 2845
38 Ga0105247_10146679 3300009101 Bacteria 1551
39 Ga0114129_10000517 3300009147 Bacteria 47115
40 Ga0114129_10137120 3300009147 Bacteria 3357
41 Ga0114129_10719604 3300009147 Bacteria 1281
42 Ga0105248_10617849 3300009177 Bacteria 1223
43 Ga0105246_10176360 3300011119 Bacteria 1641
44 Ga0157372_10199843 3300013307 Bacteria 2315
45 Ga0157379_10104714 3300014968 Bacteria 2539
46 Ga0207647_10016411 3300025904 Bacteria 5055
47 Ga0207661_10003238 3300025944 Bacteria 11281
48 Ga0207668_10090442 3300025972 Bacteria 2247
49 Ga0268266_10054058 3300028379 Bacteria 3451
50 Ga0268266_10225086 3300028379 Bacteria 1726
51 Ga0307508_10047258 3300031616 Bacteria 3840
52 Ga0307413_10071910 3300031824 Bacteria 2181
53 Ga0307407_10092745 3300031903 Bacteria 1855
54 Ga0307416_100028986 3300032002 Bacteria 4128
55 Ga0307416_100033376 3300032002 Bacteria 3900
56 Ga0307415_100005811 3300032126 Bacteria 6592
57 Ga0307415_100039354 3300032126 Bacteria 3124
58 Ga0307415_100052257 3300032126 Bacteria 2778
59 Ga0395900_0528156 3300037418 Bacteria 1127
60 Ga0451833_0110058 3300041491 Bacteria 1441
61 Ga0451837_0826278 3300041494 Bacteria 1910
62 Ga0439443_000709 3300042003 Bacteria 3221
63 Ga0439450_002056 3300042008 Bacteria 3093
64 Ga0439451_003176 3300042009 Bacteria 3338
65 Ga0439454_000179 3300042011 Bacteria 4371
66 Ga0439456_002850 3300042013 Bacteria 3487
67 Ga0439463_006480 3300042016 Bacteria 2901
68 Ga0450912_000425 3300042116 Bacteria 2038
69 Ga0450915_000369 3300042119 Bacteria 1557
70 Ga0439444_0000827 3300042437 Bacteria 3738
71 Ga0439464_0003093 3300042439 Bacteria 4163
72 Ga0439460_0006054 3300042461 Bacteria 2985
73 Ga0439440_0002599 3300042993 Bacteria 3420
74 Ga0466960_0136518 3300044901 Bacteria 1299
75 Ga0466958_0064147 3300045836 Bacteria 2240
76 Ga0495653_0192066 3300046463 Bacteria 1392
77 Ga0495584_0051496 3300046491 Bacteria 2073
78 Ga0495606_0017938 3300046507 Bacteria 5328
79 Ga0495668_0000696 3300046616 Bacteria 40415
80 Ga0495625_0001767 3300046660 Bacteria 24979
81 Ga0495683_0144106 3300047323 Bacteria 1114
82 Ga0495626_0000237 3300048091 Bacteria 63826
83 Ga0496105_0120886 3300048908 Bacteria 2160
84 Ga0496105_0250543 3300048908 Bacteria 1435
85 Ga0496105_0322480 3300048908 Bacteria 1238
86 Ga0496107_0202945 3300048910 Bacteria 1474
87 Ga0496108_0520756 3300048911 Bacteria 1038
88 Ga0496111_0355751 3300048914 Bacteria 1084
89 Ga0496112_0044969 3300048915 Bacteria 4327
90 Ga0496112_0058976 3300048915 Bacteria 3781
91 Ga0496113_0461266 3300048916 Bacteria 1021
92 Ga0496114_0360280 3300048917 Bacteria 1286
93 Ga0496115_0088735 3300048918 Bacteria 2525
94 Ga0496123_0015961 3300048926 Bacteria 6127
95 Ga0496126_0484268 3300048929 Bacteria 991
96 Ga0501032_0107147 3300049569 Bacteria 1851
97 Ga0501036_0031053 3300049572 Bacteria 4515
98 Ga0501039_0081447 3300049575 Bacteria 2520
99 Ga0501040_0019920 3300049576 Bacteria 4465
100 Ga0501043_0072014 3300049579 Bacteria 2715
101 Ga0501046_0034036 3300049580 Bacteria 4114
102 Ga0501048_0031392 3300049582 Bacteria 3842
103 Ga0501074_0021321 3300049590 Bacteria 4705
104 Ga0501075_0076505 3300049591 Bacteria 2532
105 Ga0501076_0049754 3300049592 Bacteria 3315
106 Ga0501077_0121475 3300049593 Bacteria 1656
107 Ga0501080_0372814 3300049742 Bacteria 1287
108 Ga0501081_0062277 3300049743 Bacteria 2587
109 Ga0501045_0001166 3300049824 Bacteria 17423
110 nmdc:mga05p37_230047_c1 3300050507 Bacteria 2234
111 nmdc:mga05p37_37720_c1 3300050507 Bacteria 5927
112 nmdc:mga09592_74325_c1 3300050508 Bacteria 2888
113 nmdc:mga09592_7439_c1 3300050508 Bacteria 8901
114 nmdc:mga0qj67_24015_c1 3300050509 Bacteria 4697
115 nmdc:mga0qj67_402434_c1 3300050509 Bacteria 1105
116 nmdc:mga06r32_137047_c1 3300050510 Bacteria 2422
117 nmdc:mga06r32_327455_c2 3300050510 Bacteria 1189
118 nmdc:mga06r32_5114_c1 3300050510 Bacteria 11799
119 nmdc:mga08y16_624017_c1 3300050511 Bacteria 1085
120 nmdc:mga0rr50_64586_c1 3300050513 Bacteria 2769
121 nmdc:mga0a205_27244_c1 3300050515 Bacteria 5458
122 Ga0495601_0276553 3300053077 Bacteria 1095
123 Ga0500650_0001165 3300053098 Bacteria 7668
124 Ga0501082_0056118 3300060353 Bacteria 3392
125 2559433154 2558860280 Bacteria 11429938
126 2644457022 2643221681 Bacteria 3707866
127 2753034874 2751185725 Bacteria 5740550
128 2753323391 2751185792 Bacteria 5739090
129 2887486438 2887478801 Bacteria 8972725
130 8001782576 8001781756 Bacteria 9586736
131 Ga0207674_10492116
132 JGI24739J22299_10005453
133 JGI24737J22298_10005325
134 JGI25406J46586_10036026
135 JGI25407J50210_10006271
136 Ga0070683_100001611
137 Ga0070660_100326111
138 Ga0070714_100010393
139 Ga0070662_100343176
140 Ga0070698_100001860
141 Ga0070679_100044148
142 Ga0070679_100166030
143 Ga0070684_100008493
144 Ga0070696_100006006
145 Ga0068857_100065529
146 Ga0068854_100296203
147 Ga0068856_100188071
148 Ga0068864_100057916
149 Ga0081455_10002081
150 Ga0081455_10125648
151 Ga0081538_10000388
152 Ga0081538_10026398
153 Ga0081539_10040876
154 Ga0075428_100000550
155 Ga0075428_100209193
156 Ga0075430_100000609
157 Ga0075430_100008453
158 Ga0075430_100051649
159 Ga0075431_100017641
160 Ga0075431_100081865
161 Ga0075431_100110144
162 Ga0075431_100642732
163 Ga0075433_10025762
164 Ga0075434_100045816
165 Ga0075429_100003881
166 Ga0075429_100139806
167 Ga0111539_10138934
168 Ga0105247_10146679
169 Ga0114129_10000517
170 Ga0114129_10137120
171 Ga0114129_10719604
172 Ga0105248_10617849
173 Ga0105246_10176360
174 Ga0157372_10199843
175 Ga0157379_10104714
176 Ga0207647_10016411
177 Ga0207661_10003238
178 Ga0207668_10090442
179 Ga0268266_10054058
180 Ga0268266_10225086
181 Ga0307508_10047258
182 Ga0307413_10071910
183 Ga0307407_10092745
184 Ga0307416_100028986
185 Ga0307416_100033376
186 Ga0307415_100005811
187 Ga0307415_100039354
188 Ga0307415_100052257
189 Ga0395900_0528156
190 Ga0451833_0110058
191 Ga0451837_0826278
192 Ga0439443_000709
193 Ga0439450_002056
194 Ga0439451_003176
195 Ga0439454_000179
196 Ga0439456_002850
197 Ga0439463_006480
198 Ga0450912_000425
199 Ga0450915_000369
200 Ga0439444_0000827
201 Ga0439464_0003093
202 Ga0439460_0006054
203 Ga0439440_0002599
204 Ga0466960_0136518
205 Ga0466958_0064147
206 Ga0495653_0192066
207 Ga0495584_0051496
208 Ga0495606_0017938
209 Ga0495668_0000696
210 Ga0495625_0001767
211 Ga0495683_0144106
212 Ga0495626_0000237
213 Ga0496105_0120886
214 Ga0496105_0250543
215 Ga0496105_0322480
216 Ga0496107_0202945
217 Ga0496108_0520756
218 Ga0496111_0355751
219 Ga0496112_0044969
220 Ga0496112_0058976
221 Ga0496113_0461266
222 Ga0496114_0360280
223 Ga0496115_0088735
224 Ga0496123_0015961
225 Ga0496126_0484268
226 Ga0501032_0107147
227 Ga0501036_0031053
228 Ga0501039_0081447
229 Ga0501040_0019920
230 Ga0501043_0072014
231 Ga0501046_0034036
232 Ga0501048_0031392
233 Ga0501074_0021321
234 Ga0501075_0076505
235 Ga0501076_0049754
236 Ga0501077_0121475
237 Ga0501080_0372814
238 Ga0501081_0062277
239 Ga0501045_0001166
240 nmdc:mga05p37_230047_c1
241 nmdc:mga05p37_37720_c1
242 nmdc:mga09592_74325_c1
243 nmdc:mga09592_7439_c1
244 nmdc:mga0qj67_24015_c1
245 nmdc:mga0qj67_402434_c1
246 nmdc:mga06r32_137047_c1
247 nmdc:mga06r32_327455_c2
248 nmdc:mga06r32_5114_c1
249 nmdc:mga08y16_624017_c1
250 nmdc:mga0rr50_64586_c1
251 nmdc:mga0a205_27244_c1
252 Ga0495601_0276553
253 Ga0500650_0001165
254 Ga0501082_0056118
255 2559433154
256 2644457022
257 2753034874
258 2753323391
259 2887486438
260 8001782576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

32

220

0.93

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

221

319

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.9619 2 301
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.9618 2 301
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.9615 2 301
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.9607 2 301
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.9405 2 301
ID Description Score Start End Superfamily
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9544 2 179 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9379 1 178 3.40.50.1010
3zd8A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9285 182 266 1.10.150.20
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9272 2 177 3.40.50.1010
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9213 2 180 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1C6PDU7-F1-model_v4 5'-3' exonuclease 0.9869 1 300 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7H8LQ09-F1-model_v4 deleted 0.9834 1 301
AF-A0A4R7IG96-F1-model_v4 deleted 0.9817 1 300
AF-A0A6H1K7G5-F1-model_v4 SIP domain-containing protein 0.9817 1 272 GO:0003677
GO:0008409
GO:0016491
GO:0140640
AF-A0A3N6GI33-F1-model_v4 5'-3' exonuclease (EC 3.1.11.-) 0.9803 1 301 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map