F143851

General Info

Members Datasets Scaffolds Average Seq Length
130 115 260 325

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1002527|JGI25152J39213_10025275
Length 373
Sequence MAMARFIAESKNSQFQFDWFIRTFTINTVQSSHFNLDDGMSTLPTLPLGLHGPQDVSALGLGCMGMSDLYGASDRTESLATLRAALNARINLLDTGDFYGMGHNEMLIAEALQGRRERALVSVKFGALRGPDASWLGVDGRPAAVKNFAAYSLKRLGADHIDIYRMARLDPAVPVEDTVGAIADLVKAGWVRHIGLSEVGPQTIARAHRVHPISDLQIEYSLLSRGPEDAIFPLLKELGIGVTAYGVLSRGLLSGSRPTGVQDFRSHLPRFQGENLARNAAIAGELQAVAASLGATATQVAIAWVMARGQALGVRIVPLVGSRRRTQLADALGAARLALSPEAMARIEAAVPRDAASGTRYAAEHMAHLDSEG

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
105 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
106 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
107 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
109 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
110 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
111 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
114 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
115 2891554331 Microbispora sp. CL1-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.23
Nodule 0
Rhizoplane 2.31
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002527 3300002773 Bacteria 6896
2 JGI25153J46596_10001045 3300003215 Bacteria 16864
3 JGI25153J46596_10005948 3300003215 Bacteria 6288
4 Ga0055526_1001401 3300003771 Bacteria 17146
5 Ga0070683_100000284 3300005329 Bacteria 34793
6 Ga0070670_100000083 3300005331 Bacteria 91017
7 Ga0068869_100020149 3300005334 Bacteria 4568
8 Ga0068869_100032031 3300005334 Bacteria 3702
9 Ga0070666_10005739 3300005335 Bacteria 7621
10 Ga0070666_10081989 3300005335 Bacteria 2205
11 Ga0068868_100000480 3300005338 Bacteria 26510
12 Ga0070689_100011651 3300005340 Bacteria 6305
13 Ga0070675_100008714 3300005354 Bacteria 7879
14 Ga0070674_100122564 3300005356 Bacteria 1927
15 Ga0070713_100003544 3300005436 Bacteria 10306
16 Ga0070705_100107360 3300005440 Bacteria 1776
17 Ga0070708_100115657 3300005445 Bacteria 2469
18 Ga0070679_100023141 3300005530 Bacteria 6079
19 Ga0070684_100000776 3300005535 Bacteria 22143
20 Ga0068854_100000784 3300005578 Bacteria 18886
21 Ga0068859_100389150 3300005617 Bacteria 1490
22 Ga0068864_100335780 3300005618 Bacteria 1423
23 Ga0068866_10059415 3300005718 Bacteria 1978
24 Ga0068851_10026455 3300005834 Unclassified 2851
25 Ga0068863_100058531 3300005841 Bacteria 3646
26 Ga0068863_100122006 3300005841 Bacteria 2486
27 Ga0081455_10109733 3300005937 Bacteria 2195
28 Ga0070717_10098057 3300006028 Bacteria 2484
29 Ga0075365_10036120 3300006038 Bacteria 3201
30 Ga0075364_10026194 3300006051 Bacteria 3718
31 Ga0075428_100098928 3300006844 Bacteria 3180
32 Ga0075430_100067173 3300006846 Bacteria 3010
33 Ga0075431_100021454 3300006847 Bacteria 6606
34 Ga0075429_100407011 3300006880 Bacteria 1192
35 Ga0097620_100389182 3300006931 Bacteria 1490
36 Ga0105240_10147337 3300009093 Bacteria 2807
37 Ga0105245_10000722 3300009098 Bacteria 29759
38 Ga0114129_10060703 3300009147 Bacteria 5286
39 Ga0105241_10000435 3300009174 Bacteria 31472
40 Ga0105248_10326492 3300009177 Bacteria 1728
41 Ga0105237_10041680 3300009545 Unclassified 4629
42 Ga0105249_10017052 3300009553 Bacteria 6445
43 Ga0105239_10183599 3300010375 Bacteria 2340
44 Ga0157369_10039859 3300013105 Bacteria 5132
45 Ga0157369_10050790 3300013105 Bacteria 4489
46 Ga0157369_10356791 3300013105 Bacteria 1518
47 Ga0157378_10003937 3300013297 Bacteria 13137
48 Ga0157372_10037379 3300013307 Bacteria 5356
49 Ga0157380_10044129 3300014326 Bacteria 3492
50 Ga0157376_10212745 3300014969 Bacteria 1786
51 Ga0207425_1000151 3300025245 Bacteria 59370
52 Ga0209129_1000038 3300025258 Bacteria 322778
53 Ga0209673_1016470 3300025273 Bacteria 2763
54 Ga0209564_1000129 3300025295 Bacteria 195163
55 Ga0209758_1000177 3300025297 Bacteria 142824
56 Ga0209758_1000197 3300025297 Bacteria 133706
57 Ga0209257_1014367 3300025304 Bacteria 3406
58 Ga0207643_10079699 3300025908 Bacteria 1896
59 Ga0207705_10016653 3300025909 Bacteria 5265
60 Ga0207654_10000107 3300025911 Bacteria 55194
61 Ga0207695_10140707 3300025913 Bacteria 2362
62 Ga0207694_10128008 3300025924 Bacteria 2033
63 Ga0207650_10000108 3300025925 Bacteria 109507
64 Ga0207687_10000933 3300025927 Bacteria 19935
65 Ga0207700_10043738 3300025928 Bacteria 3292
66 Ga0207670_10145427 3300025936 Bacteria 1753
67 Ga0207669_10140592 3300025937 Bacteria 1675
68 Ga0207669_10236702 3300025937 Bacteria 1351
69 Ga0207689_10025290 3300025942 Bacteria 4975
70 Ga0207689_10112372 3300025942 Bacteria 2239
71 Ga0207661_10000013 3300025944 Bacteria 348811
72 Ga0207640_10001316 3300025981 Bacteria 13468
73 Ga0207677_10000105 3300026023 Bacteria 69286
74 Ga0207677_10111509 3300026023 Bacteria 2038
75 Ga0207703_10263547 3300026035 Bacteria 1558
76 Ga0207639_10156117 3300026041 Bacteria 1917
77 Ga0207641_10062640 3300026088 Bacteria 3175
78 Ga0207676_10289216 3300026095 Bacteria 1491
79 Ga0207674_10383522 3300026116 Bacteria 1359
80 Ga0207683_10078305 3300026121 Bacteria 2929
81 Ga0268264_10088270 3300028381 Bacteria 2668
82 Ga0265338_10043729 3300028800 Bacteria 4149
83 Ga0265332_10031001 3300031238 Bacteria 2333
84 Ga0307513_10005354 3300031456 Bacteria 16968
85 Ga0307509_10000149 3300031507 Bacteria 107058
86 Ga0307509_10008874 3300031507 Bacteria 12682
87 Ga0307509_10211541 3300031507 Bacteria 1763
88 Ga0307415_100024626 3300032126 Bacteria 3762
89 Ga0373961_0000050 3300035241 Bacteria 68925
90 Ga0373927_0031896 3300035695 Bacteria 3432
91 Ga0373925_0544419 3300037068 Bacteria 954
92 Ga0395905_0183693 3300037471 Bacteria 1963
93 Ga0451835_0370689 3300041492 Bacteria 1400
94 Ga0451841_0033206 3300041498 Bacteria 1919
95 Ga0451851_1220713 3300041507 Bacteria 2142
96 Ga0451853_0528269 3300041512 Bacteria 17428
97 Ga0439445_0028556 3300042004 Bacteria 1439
98 Ga0466969_0111154 3300044656 Bacteria 1282
99 Ga0466972_0040905 3300044658 Bacteria 2257
100 Ga0466967_0087638 3300045976 Bacteria 2823
101 Ga0495650_0028519 3300046471 Bacteria 2561
102 Ga0495580_0137087 3300046472 Bacteria 1697
103 Ga0495580_0147576 3300046472 Bacteria 1630
104 Ga0495645_0194132 3300046543 Bacteria 1381
105 Ga0495669_0004512 3300046684 Bacteria 5755
106 Ga0495613_0077950 3300046689 Bacteria 2411
107 Ga0495613_0078073 3300046689 Bacteria 2409
108 Ga0495672_0072567 3300047320 Bacteria 1944
109 Ga0495679_010911 3300047446 Bacteria 3538
110 Ga0495685_057396 3300047447 Bacteria 1315
111 Ga0496105_0269104 3300048908 Bacteria 1376
112 Ga0496107_0386053 3300048910 Bacteria 1042
113 Ga0496110_0294622 3300048913 Bacteria 1478
114 Ga0501036_0011662 3300049572 Bacteria 7283
115 nmdc:mga00v17_99700_c1 3300050491 Bacteria 1832
116 nmdc:mga0yw44_39622_c1 3300050492 Bacteria 2795
117 nmdc:mga06r32_338288_c1 3300050510 Bacteria 1490
118 Ga0500635_0002034 3300053080 Bacteria 4945
119 Ga0500578_0157922 3300053086 Bacteria 1409
120 Ga0500644_0017137 3300053088 Bacteria 2097
121 Ga0500566_0002204 3300053094 Bacteria 11498
122 Ga0500566_0004460 3300053094 Bacteria 8354
123 Ga0500641_0005131 3300053096 Bacteria 4639
124 Ga0500555_003437 3300053103 Bacteria 4516
125 Ga0500590_139146 3300053148 Bacteria 1112
126 Ga0500603_002383 3300053150 Bacteria 4124
127 Ga0500616_0000278 3300053153 Bacteria 75900
128 2644440219 2643221678 Bacteria 9540101
129 2891398038 2891395885 Bacteria 9251614
130 2891556591 2891554331 Bacteria 8812224
131 JGI25152J39213_1002527
132 JGI25153J46596_10001045
133 JGI25153J46596_10005948
134 Ga0055526_1001401
135 Ga0070683_100000284
136 Ga0070670_100000083
137 Ga0068869_100020149
138 Ga0068869_100032031
139 Ga0070666_10005739
140 Ga0070666_10081989
141 Ga0068868_100000480
142 Ga0070689_100011651
143 Ga0070675_100008714
144 Ga0070674_100122564
145 Ga0070713_100003544
146 Ga0070705_100107360
147 Ga0070708_100115657
148 Ga0070679_100023141
149 Ga0070684_100000776
150 Ga0068854_100000784
151 Ga0068859_100389150
152 Ga0068864_100335780
153 Ga0068866_10059415
154 Ga0068851_10026455
155 Ga0068863_100058531
156 Ga0068863_100122006
157 Ga0081455_10109733
158 Ga0070717_10098057
159 Ga0075365_10036120
160 Ga0075364_10026194
161 Ga0075428_100098928
162 Ga0075430_100067173
163 Ga0075431_100021454
164 Ga0075429_100407011
165 Ga0097620_100389182
166 Ga0105240_10147337
167 Ga0105245_10000722
168 Ga0114129_10060703
169 Ga0105241_10000435
170 Ga0105248_10326492
171 Ga0105237_10041680
172 Ga0105249_10017052
173 Ga0105239_10183599
174 Ga0157369_10039859
175 Ga0157369_10050790
176 Ga0157369_10356791
177 Ga0157378_10003937
178 Ga0157372_10037379
179 Ga0157380_10044129
180 Ga0157376_10212745
181 Ga0207425_1000151
182 Ga0209129_1000038
183 Ga0209673_1016470
184 Ga0209564_1000129
185 Ga0209758_1000177
186 Ga0209758_1000197
187 Ga0209257_1014367
188 Ga0207643_10079699
189 Ga0207705_10016653
190 Ga0207654_10000107
191 Ga0207695_10140707
192 Ga0207694_10128008
193 Ga0207650_10000108
194 Ga0207687_10000933
195 Ga0207700_10043738
196 Ga0207670_10145427
197 Ga0207669_10140592
198 Ga0207669_10236702
199 Ga0207689_10025290
200 Ga0207689_10112372
201 Ga0207661_10000013
202 Ga0207640_10001316
203 Ga0207677_10000105
204 Ga0207677_10111509
205 Ga0207703_10263547
206 Ga0207639_10156117
207 Ga0207641_10062640
208 Ga0207676_10289216
209 Ga0207674_10383522
210 Ga0207683_10078305
211 Ga0268264_10088270
212 Ga0265338_10043729
213 Ga0265332_10031001
214 Ga0307513_10005354
215 Ga0307509_10000149
216 Ga0307509_10008874
217 Ga0307509_10211541
218 Ga0307415_100024626
219 Ga0373961_0000050
220 Ga0373927_0031896
221 Ga0373925_0544419
222 Ga0395905_0183693
223 Ga0451835_0370689
224 Ga0451841_0033206
225 Ga0451851_1220713
226 Ga0451853_0528269
227 Ga0439445_0028556
228 Ga0466969_0111154
229 Ga0466972_0040905
230 Ga0466967_0087638
231 Ga0495650_0028519
232 Ga0495580_0137087
233 Ga0495580_0147576
234 Ga0495645_0194132
235 Ga0495669_0004512
236 Ga0495613_0077950
237 Ga0495613_0078073
238 Ga0495672_0072567
239 Ga0495679_010911
240 Ga0495685_057396
241 Ga0496105_0269104
242 Ga0496107_0386053
243 Ga0496110_0294622
244 Ga0501036_0011662
245 nmdc:mga00v17_99700_c1
246 nmdc:mga0yw44_39622_c1
247 nmdc:mga06r32_338288_c1
248 Ga0500635_0002034
249 Ga0500578_0157922
250 Ga0500644_0017137
251 Ga0500566_0002204
252 Ga0500566_0004460
253 Ga0500641_0005131
254 Ga0500555_003437
255 Ga0500590_139146
256 Ga0500603_002383
257 Ga0500616_0000278
258 2644440219
259 2891398038
260 2891556591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

352

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9216 43 352
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9115 43 353
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8948 43 366
3uyi-assembly1.cif.gz_A-2 crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8942 43 361
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8912 43 352
ID Description Score Start End Superfamily
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9461 44 288 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9411 43 363 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9267 116 373 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.926 51 370 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9176 43 261 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.9736 43 249 GO:0004033
GO:0005737
AF-A0A414PN53-F1-model_v4 Aldo/keto reductase 0.9725 139 255 GO:0004033
GO:0005737
AF-H6CPI4-F1-model_v4 deleted 0.9713 52 206
AF-A0A4Q3GSW9-F1-model_v4 Aldo/keto reductase 0.969 43 249 GO:0004033
GO:0005737
AF-B9KUJ6-F1-model_v4 deleted 0.9688 40 352

Map