F141855

General Info

Members Datasets Scaffolds Average Seq Length
129 101 258 286

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10483638|Ga0157375_104836382
Length 311
Sequence MAPADFVAGDRAPTRYGGEVSNGPVAGLTVAATPRTGTLSAPLTDAATAAELLRGRRVVALTGAGMSTDSGIPDYRGPDSPPRSPMTYDEFASGPAQQQRYWARSHIGWQRLGQARPNSGHRAVAALEAAGVLADLITQNVDGLHQQAGSRAVIDLHGRIDEVICLGCRAVSGRLDLHHRLDALNPGFGDTAAVTTAPDGDVDFEDTAGFRLAPCLDCGGPLKPHVVFFGENVPRDRVDRAYLAVDRARALLVAGSSLTVMSGLRFVRHAARAGTPIVIVNRGITRGDPLATCRIDAGCSETLTALVELLG

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
56 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
57 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
60 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
61 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
62 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
71 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
93 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
94 2643221593 Lysobacter sp. Root690 Isolate Unclassified
95 2643221604 Nocardioides sp. Root190 Isolate Unclassified
96 2738541305 Nocardioides sp. CF167 Isolate Unclassified
97 2773857759 Microbacterium sp. 1294 Isolate Unclassified
98 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
99 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
100 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
101 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.8
Metatranscriptomes 0
Isolates 6.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 17.05
Rhizosphere 62.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10483638 3300013308 Bacteria 1403
2 Ga0070670_100448926 3300005331 Bacteria 1142
3 Ga0070689_100093300 3300005340 Bacteria 2376
4 Ga0070688_100105267 3300005365 Bacteria 1867
5 Ga0070678_100003421 3300005456 Bacteria 8852
6 Ga0070678_100035294 3300005456 Bacteria 3489
7 Ga0070678_100151864 3300005456 Bacteria 1866
8 Ga0070678_100245078 3300005456 Bacteria 1500
9 Ga0070678_100376783 3300005456 Bacteria 1227
10 Ga0070684_100169683 3300005535 Bacteria 1982
11 Ga0068853_100009994 3300005539 Bacteria 7663
12 Ga0068853_100020602 3300005539 Bacteria 5484
13 Ga0070693_100043530 3300005547 Bacteria 2536
14 Ga0068855_100006527 3300005563 Bacteria 14184
15 Ga0068856_100090287 3300005614 Bacteria 3047
16 Ga0068852_100030125 3300005616 Bacteria 4464
17 Ga0068859_100436683 3300005617 Bacteria 1405
18 Ga0068864_100307456 3300005618 Bacteria 1486
19 Ga0081539_10038221 3300005985 Bacteria 2847
20 Ga0081539_10067848 3300005985 Bacteria 1927
21 Ga0068871_100579562 3300006358 Bacteria 1018
22 Ga0097620_100436670 3300006931 Bacteria 1405
23 Ga0111539_10228796 3300009094 Bacteria 2165
24 Ga0105245_10135261 3300009098 Bacteria 2316
25 Ga0105242_10181143 3300009176 Bacteria 1859
26 Ga0105248_10280325 3300009177 Bacteria 1876
27 Ga0105238_10010062 3300009551 Bacteria 9488
28 Ga0105249_10086859 3300009553 Bacteria 2917
29 Ga0105239_10316295 3300010375 Bacteria 1760
30 Ga0157370_10040121 3300013104 Bacteria 4520
31 Ga0157369_10000030 3300013105 Bacteria 203569
32 Ga0163162_10005602 3300013306 Bacteria 12138
33 Ga0163162_10417954 3300013306 Bacteria 1473
34 Ga0157372_10125534 3300013307 Bacteria 2950
35 Ga0157375_10047054 3300013308 Bacteria 4209
36 Ga0163163_10147348 3300014325 Bacteria 2398
37 Ga0163163_10228404 3300014325 Bacteria 1910
38 Ga0163163_10301481 3300014325 Bacteria 1655
39 Ga0157376_10056029 3300014969 Bacteria 3292
40 Ga0207425_1007224 3300025245 Bacteria 2954
41 Ga0209025_1000015 3300025294 Bacteria 808120
42 Ga0209758_1007353 3300025297 Bacteria 7534
43 Ga0207695_10003293 3300025913 Bacteria 22933
44 Ga0207671_10001525 3300025914 Bacteria 26570
45 Ga0207694_10025084 3300025924 Bacteria 4529
46 Ga0207686_10080635 3300025934 Bacteria 2122
47 Ga0207704_10533632 3300025938 Bacteria 951
48 Ga0207711_10443623 3300025941 Bacteria 1208
49 Ga0207689_10112586 3300025942 Bacteria 2237
50 Ga0207689_10356399 3300025942 Bacteria 1216
51 Ga0207667_10025052 3300025949 Bacteria 6540
52 Ga0207712_10092085 3300025961 Bacteria 2234
53 Ga0207639_10034049 3300026041 Bacteria 3763
54 Ga0207639_10073771 3300026041 Bacteria 2676
55 Ga0207639_10101222 3300026041 Bacteria 2329
56 Ga0207702_10061474 3300026078 Bacteria 3204
57 Ga0207641_10093479 3300026088 Bacteria 2636
58 Ga0207648_10015022 3300026089 Bacteria 7132
59 Ga0207683_10031367 3300026121 Bacteria 4612
60 Ga0207683_10043100 3300026121 Bacteria 3942
61 Ga0207683_10119708 3300026121 Bacteria 2362
62 Ga0207698_10056596 3300026142 Bacteria 3029
63 Ga0268264_10266546 3300028381 Bacteria 1598
64 Ga0307508_10193297 3300031616 Bacteria 1636
65 Ga0307516_10125997 3300031730 Bacteria 2346
66 Ga0307406_10005135 3300031901 Bacteria 7142
67 Ga0395900_0118720 3300037418 Bacteria 2714
68 Ga0395898_0009523 3300037466 Bacteria 10200
69 Ga0395901_0342492 3300038443 Bacteria 1544
70 Ga0395901_0537967 3300038443 Bacteria 1185
71 Ga0439447_011260 3300041407 Bacteria 2619
72 Ga0451789_0205106 3300041443 Bacteria 2724
73 Ga0451791_1573311 3300041451 Bacteria 1756
74 Ga0451793_1243686 3300041452 Bacteria 4473
75 Ga0451797_1269369 3300041453 Bacteria 1554
76 Ga0451839_0122013 3300041496 Bacteria 1310
77 Ga0451839_0310011 3300041496 Bacteria 1537
78 Ga0451841_0020120 3300041498 Bacteria 1993
79 Ga0451841_0985100 3300041498 Bacteria 1657
80 Ga0451849_0073205 3300041505 Bacteria 5800
81 Ga0451853_0088288 3300041512 Bacteria 2059
82 Ga0451853_0275596 3300041512 Bacteria 6759
83 Ga0451853_3833907 3300041512 Bacteria 1656
84 Ga0451577_0067223 3300042876 Bacteria 3196
85 Ga0466971_0095811 3300044719 Bacteria 1361
86 Ga0466970_0008388 3300044765 Bacteria 5199
87 Ga0466957_0190704 3300044842 Bacteria 1343
88 Ga0466960_0242349 3300044901 Bacteria 999
89 Ga0466960_0287915 3300044901 Bacteria 922
90 Ga0466967_0053554 3300045976 Bacteria 3547
91 Ga0495641_0132931 3300046461 Bacteria 1111
92 Ga0495608_0150930 3300046511 Bacteria 1481
93 Ga0495668_0005596 3300046616 Bacteria 8448
94 Ga0495658_0316393 3300046683 Bacteria 989
95 Ga0495624_0076651 3300046690 Bacteria 2075
96 Ga0496100_0064273 3300048903 Bacteria 2428
97 Ga0496102_0060698 3300048905 Bacteria 3459
98 Ga0496102_0415488 3300048905 Bacteria 1264
99 Ga0496103_0021352 3300048906 Bacteria 3894
100 Ga0496104_0060208 3300048907 Bacteria 3597
101 Ga0496105_0002543 3300048908 Bacteria 13233
102 Ga0496108_0004192 3300048911 Bacteria 11611
103 Ga0496108_0205707 3300048911 Bacteria 1708
104 Ga0496108_0207408 3300048911 Bacteria 1701
105 Ga0496109_0009107 3300048912 Bacteria 8453
106 Ga0496110_0000837 3300048913 Bacteria 21641
107 Ga0496111_0000618 3300048914 Bacteria 18794
108 Ga0496113_0021848 3300048916 Bacteria 4518
109 Ga0496114_0001036 3300048917 Bacteria 20908
110 Ga0496114_0002571 3300048917 Bacteria 13860
111 Ga0496114_0070058 3300048917 Bacteria 2945
112 Ga0496114_0214815 3300048917 Bacteria 1687
113 Ga0496115_0190845 3300048918 Bacteria 1693
114 Ga0496118_0004511 3300048921 Bacteria 16463
115 Ga0501039_0415918 3300049575 Bacteria 1056
116 Ga0501067_0290352 3300049583 Bacteria 910
117 Ga0501068_0135922 3300049584 Bacteria 1539
118 nmdc:mga0yw44_4378_c1 3300050492 Bacteria 6465
119 Ga0500573_0001251 3300053140 Bacteria 11981
120 Ga0500573_0176436 3300053140 Bacteria 1152
121 Ga0500616_0000125 3300053153 Bacteria 135146
122 2643974201 2643221593 Bacteria 6296053
123 2644031934 2643221604 Bacteria 5014917
124 2738870828 2738541305 Bacteria 4910150
125 2774384641 2773857759 Bacteria 2963774
126 2812334686 2811994874 Bacteria 5367947
127 2884700507 2884693830 Bacteria 11273186
128 2895450273 2895442618 Bacteria 11027144
129 2977253776 2977251589 Bacteria 2952848
130 Ga0157375_10483638
131 Ga0070670_100448926
132 Ga0070689_100093300
133 Ga0070688_100105267
134 Ga0070678_100003421
135 Ga0070678_100035294
136 Ga0070678_100151864
137 Ga0070678_100245078
138 Ga0070678_100376783
139 Ga0070684_100169683
140 Ga0068853_100009994
141 Ga0068853_100020602
142 Ga0070693_100043530
143 Ga0068855_100006527
144 Ga0068856_100090287
145 Ga0068852_100030125
146 Ga0068859_100436683
147 Ga0068864_100307456
148 Ga0081539_10038221
149 Ga0081539_10067848
150 Ga0068871_100579562
151 Ga0097620_100436670
152 Ga0111539_10228796
153 Ga0105245_10135261
154 Ga0105242_10181143
155 Ga0105248_10280325
156 Ga0105238_10010062
157 Ga0105249_10086859
158 Ga0105239_10316295
159 Ga0157370_10040121
160 Ga0157369_10000030
161 Ga0163162_10005602
162 Ga0163162_10417954
163 Ga0157372_10125534
164 Ga0157375_10047054
165 Ga0163163_10147348
166 Ga0163163_10228404
167 Ga0163163_10301481
168 Ga0157376_10056029
169 Ga0207425_1007224
170 Ga0209025_1000015
171 Ga0209758_1007353
172 Ga0207695_10003293
173 Ga0207671_10001525
174 Ga0207694_10025084
175 Ga0207686_10080635
176 Ga0207704_10533632
177 Ga0207711_10443623
178 Ga0207689_10112586
179 Ga0207689_10356399
180 Ga0207667_10025052
181 Ga0207712_10092085
182 Ga0207639_10034049
183 Ga0207639_10073771
184 Ga0207639_10101222
185 Ga0207702_10061474
186 Ga0207641_10093479
187 Ga0207648_10015022
188 Ga0207683_10031367
189 Ga0207683_10043100
190 Ga0207683_10119708
191 Ga0207698_10056596
192 Ga0268264_10266546
193 Ga0307508_10193297
194 Ga0307516_10125997
195 Ga0307406_10005135
196 Ga0395900_0118720
197 Ga0395898_0009523
198 Ga0395901_0342492
199 Ga0395901_0537967
200 Ga0439447_011260
201 Ga0451789_0205106
202 Ga0451791_1573311
203 Ga0451793_1243686
204 Ga0451797_1269369
205 Ga0451839_0122013
206 Ga0451839_0310011
207 Ga0451841_0020120
208 Ga0451841_0985100
209 Ga0451849_0073205
210 Ga0451853_0088288
211 Ga0451853_0275596
212 Ga0451853_3833907
213 Ga0451577_0067223
214 Ga0466971_0095811
215 Ga0466970_0008388
216 Ga0466957_0190704
217 Ga0466960_0242349
218 Ga0466960_0287915
219 Ga0466967_0053554
220 Ga0495641_0132931
221 Ga0495608_0150930
222 Ga0495668_0005596
223 Ga0495658_0316393
224 Ga0495624_0076651
225 Ga0496100_0064273
226 Ga0496102_0060698
227 Ga0496102_0415488
228 Ga0496103_0021352
229 Ga0496104_0060208
230 Ga0496105_0002543
231 Ga0496108_0004192
232 Ga0496108_0205707
233 Ga0496108_0207408
234 Ga0496109_0009107
235 Ga0496110_0000837
236 Ga0496111_0000618
237 Ga0496113_0021848
238 Ga0496114_0001036
239 Ga0496114_0002571
240 Ga0496114_0070058
241 Ga0496114_0214815
242 Ga0496115_0190845
243 Ga0496118_0004511
244 Ga0501039_0415918
245 Ga0501067_0290352
246 Ga0501068_0135922
247 nmdc:mga0yw44_4378_c1
248 Ga0500573_0001251
249 Ga0500573_0176436
250 Ga0500616_0000125
251 2643974201
252 2644031934
253 2738870828
254 2774384641
255 2812334686
256 2884700507
257 2895450273
258 2977253776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

63

262

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oj7-assembly1.cif.gz_A sirtuin 4 orthologue from xenopus tropicalis in complex with adp-ribose 0.953 14 277
5ojn-assembly1.cif.gz_A sirtuin 4 from xenopus tropicalis in complex with thioacetyl-adp-ribose 0.9326 14 277
2h2f-assembly1.cif.gz_A the structural basis for sirtuin substrate affinity 0.9261 17 276
3d4b-assembly1.cif.gz_A crystal structure of sir2tm in complex with acetyl p53 peptide and dadme-nad+ 0.9226 15 280
2h4h-assembly1.cif.gz_A sir2 h116y mutant-p53 peptide-nad 0.9194 15 280
ID Description Score Start End Superfamily
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9586 16 277 3.40.50.1220
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9533 16 278 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9464 16 280 3.40.50.1220
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9411 16 277 3.40.50.1220
af_A4I0H7_7_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9395 16 281 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A6G6Z3D1-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9937 17 279 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A1Q8IR01-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9918 19 281 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A193LIC1-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9914 15 280 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-H5YB11-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.991 18 279 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-Q7VX46-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9902 14 281 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Map