F138257

General Info

Members Datasets Scaffolds Average Seq Length
128 105 128 148

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10013078|Ga0207709_100130784
Length 144
Sequence VSDRLDHVSGYYAALDTGDADLIAAYFTDDAVHYYTRLGPHAGGRTIAVHAAWAYEHLNAVEGDDEVVIEWTMTWRDPESGARRLDRGTEWFRFRDGKIAEVRAYHHGGKKNPQGDLLGFDHADRGYTMLADWKAPAGGGGRQA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
104 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 11.72
Rhizosphere 85.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10124302 3300003659 Bacteria 544
2 Ga0070689_100728532 3300005340 Bacteria 868
3 Ga0070669_100157220 3300005353 Bacteria 1764
4 Ga0070675_101232026 3300005354 Bacteria 689
5 Ga0070674_101514822 3300005356 Bacteria 603
6 Ga0070659_100025318 3300005366 Bacteria 4556
7 Ga0070714_100730125 3300005435 Bacteria 957
8 Ga0070711_100037347 3300005439 Bacteria 3259
9 Ga0070694_100371753 3300005444 Bacteria 1113
10 Ga0068867_100014621 3300005459 Bacteria 5561
11 Ga0070685_10000058 3300005466 Bacteria 64666
12 Ga0070684_100541577 3300005535 Bacteria 1080
13 Ga0070704_100919399 3300005549 Unclassified 788
14 Ga0068854_100000133 3300005578 Bacteria 51376
15 Ga0068856_100008918 3300005614 Bacteria 9756
16 Ga0068856_100126160 3300005614 Bacteria 2562
17 Ga0070702_100178478 3300005615 Bacteria 1388
18 Ga0068864_100000023 3300005618 Bacteria 257064
19 Ga0068866_10000563 3300005718 Bacteria 16861
20 Ga0068851_10518766 3300005834 Bacteria 716
21 Ga0068870_10132894 3300005840 Bacteria 1448
22 Ga0081538_10190231 3300005981 Bacteria 862
23 Ga0081540_1007329 3300005983 Bacteria 7889
24 Ga0081540_1063109 3300005983 Bacteria 1755
25 Ga0081539_10003837 3300005985 Bacteria 17649
26 Ga0075364_10085620 3300006051 Bacteria 2087
27 Ga0075364_10105782 3300006051 Bacteria 1875
28 Ga0075432_10054992 3300006058 Bacteria 1410
29 Ga0070712_100014345 3300006175 Bacteria 5087
30 Ga0097621_100177366 3300006237 Bacteria 1840
31 Ga0068865_100000024 3300006881 Bacteria 94969
32 Ga0105245_10022144 3300009098 Bacteria 5580
33 Ga0105245_10042735 3300009098 Bacteria 4043
34 Ga0105243_10558339 3300009148 Bacteria 1095
35 Ga0105242_10022019 3300009176 Bacteria 5008
36 Ga0105248_10000017 3300009177 Bacteria 298089
37 Ga0105239_10464655 3300010375 Bacteria 1436
38 Ga0105239_11255744 3300010375 Bacteria 854
39 Ga0157371_10001783 3300013102 Bacteria 21764
40 Ga0157369_10000068 3300013105 Bacteria 144274
41 Ga0157378_10032970 3300013297 Bacteria 4578
42 Ga0157372_10000239 3300013307 Bacteria 60707
43 Ga0163163_10151487 3300014325 Bacteria 2363
44 Ga0157376_10017052 3300014969 Bacteria 5531
45 Ga0207656_10003210 3300025321 Bacteria 5591
46 Ga0207642_10000038 3300025899 Bacteria 38220
47 Ga0207643_10034230 3300025908 Bacteria 2846
48 Ga0207693_10003015 3300025915 Bacteria 14567
49 Ga0207663_10286065 3300025916 Bacteria 1226
50 Ga0207681_10142962 3300025923 Bacteria 1784
51 Ga0207659_10993041 3300025926 Bacteria 722
52 Ga0207687_10000025 3300025927 Bacteria 175177
53 Ga0207687_10021722 3300025927 Bacteria 4266
54 Ga0207700_10000019 3300025928 Bacteria 183117
55 Ga0207690_10034476 3300025932 Bacteria 3262
56 Ga0207686_10346043 3300025934 Bacteria 1118
57 Ga0207709_10013078 3300025935 Bacteria 4575
58 Ga0207670_10604481 3300025936 Bacteria 901
59 Ga0207669_10000010 3300025937 Bacteria 150070
60 Ga0207669_10144516 3300025937 Bacteria 1656
61 Ga0207704_10000054 3300025938 Bacteria 79155
62 Ga0207711_10000011 3300025941 Bacteria 518817
63 Ga0207661_11029295 3300025944 Bacteria 758
64 Ga0207640_10000147 3300025981 Bacteria 51462
65 Ga0207702_10000326 3300026078 Bacteria 54674
66 Ga0207702_10344695 3300026078 Bacteria 1424
67 Ga0207648_10008333 3300026089 Bacteria 10057
68 Ga0207676_10000025 3300026095 Bacteria 261714
69 Ga0207674_10076824 3300026116 Bacteria 3347
70 Ga0207674_10444991 3300026116 Bacteria 1252
71 Ga0316574_0221629 3300035398 Bacteria 1212
72 Ga0373937_0313447 3300036401 Bacteria 1484
73 Ga0395900_0277623 3300037418 Bacteria 1669
74 Ga0395898_0051321 3300037466 Bacteria 4034
75 Ga0395898_0355908 3300037466 Bacteria 1396
76 Ga0451807_2310402 3300041486 Unclassified 680
77 Ga0466963_0008793 3300044694 Bacteria 6066
78 Ga0466957_0054874 3300044842 Bacteria 2434
79 Ga0466958_0034335 3300045836 Bacteria 3026
80 Ga0466967_0000272 3300045976 Bacteria 22803
81 Ga0466967_2222111 3300045976 Bacteria 544
82 Ga0495590_0255998 3300046457 Bacteria 652
83 Ga0495653_0617186 3300046463 Bacteria 665
84 Ga0495662_0002846 3300046476 Bacteria 8752
85 Ga0495664_0780378 3300046477 Bacteria 562
86 Ga0495608_0000042 3300046511 Bacteria 115906
87 Ga0495667_0722737 3300046559 Unclassified 616
88 Ga0495656_0025103 3300046615 Bacteria 2359
89 Ga0495625_0004612 3300046660 Bacteria 12954
90 Ga0495635_0020681 3300046663 Bacteria 4584
91 Ga0495657_0000040 3300046675 Bacteria 115899
92 Ga0495599_0191283 3300046678 Bacteria 1259
93 Ga0495646_0251757 3300046680 Bacteria 946
94 Ga0495647_0127397 3300046681 Bacteria 1076
95 Ga0495613_0000324 3300046689 Bacteria 42895
96 Ga0495670_0015455 3300046691 Bacteria 3750
97 Ga0495600_0072436 3300046809 Bacteria 2251
98 Ga0495604_0001593 3300047317 Bacteria 18689
99 Ga0495675_0000051 3300047444 Bacteria 80375
100 Ga0495602_0000038 3300048088 Bacteria 130758
101 Ga0496106_0191374 3300048909 Bacteria 1627
102 Ga0496108_0065887 3300048911 Bacteria 3054
103 Ga0496110_0000281 3300048913 Bacteria 33171
104 Ga0496110_0079185 3300048913 Bacteria 2925
105 Ga0496111_0000037 3300048914 Bacteria 52978
106 Ga0496111_0021032 3300048914 Bacteria 4550
107 Ga0496111_0027775 3300048914 Bacteria 4007
108 Ga0496111_0721991 3300048914 Bacteria 724
109 Ga0496112_0004100 3300048915 Bacteria 12248
110 Ga0496112_0611044 3300048915 Bacteria 1022
111 Ga0496112_0788389 3300048915 Bacteria 875
112 Ga0496113_0000002 3300048916 Bacteria 220193
113 Ga0496113_0017855 3300048916 Bacteria 4932
114 Ga0496113_0334959 3300048916 Bacteria 1213
115 Ga0501042_0607233 3300049578 Bacteria 795
116 Ga0501067_0041882 3300049583 Bacteria 2543
117 Ga0501069_0120640 3300049585 Bacteria 1497
118 Ga0501079_0600054 3300049741 Bacteria 866
119 nmdc:mga00v17_197427_c1 3300050491 Bacteria 1300
120 nmdc:mga00v17_369112_c1 3300050491 Bacteria 933
121 nmdc:mga0a205_13717_c1 3300050515 Bacteria 7550
122 Ga0495601_0000019 3300053077 Bacteria 161673
123 Ga0495612_0063197 3300053078 Bacteria 1535
124 Ga0495595_0000009 3300053084 Bacteria 193039
125 Ga0495595_0011855 3300053084 Bacteria 3654
126 Ga0495619_0000057 3300053085 Bacteria 93948
127 Ga0495619_0000069 3300053085 Bacteria 82755
128 Ga0495619_0002691 3300053085 Bacteria 11627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100157220 Ga0070669_1001572202 138
2 3300005459 Ga0068867_100014621 Ga0068867_1000146214 138
3 3300005535 Ga0070684_100541577 Ga0070684_1005415773 138
4 3300025923 Ga0207681_10142962 Ga0207681_101429623 138
5 3300026089 Ga0207648_10008333 Ga0207648_100083334 138
6 3300046559 Ga0495667_0722737 Ga0495667_0722737_44_463 138
7 3300048915 Ga0496112_0611044 Ga0496112_0611044_329_748 138
8 3300048916 Ga0496113_0017855 Ga0496113_0017855_3454_3873 138
9 3300006237 Ga0097621_100177366 Ga0097621_1001773663 139
10 3300014325 Ga0163163_10151487 Ga0163163_101514873 139
11 3300046691 Ga0495670_0015455 Ga0495670_0015455_2852_3274 139
12 3300048911 Ga0496108_0065887 Ga0496108_0065887_392_811 139
13 3300048916 Ga0496113_0334959 Ga0496113_0334959_540_959 139
14 3300013102 Ga0157371_10001783 Ga0157371_1000178321 140
15 3300013105 Ga0157369_10000068 Ga0157369_1000006873 140
16 3300026116 Ga0207674_10076824 Ga0207674_100768245 140
17 3300036401 Ga0373937_0313447 Ga0373937_0313447_566_988 140
18 3300046463 Ga0495653_0617186 Ga0495653_0617186_215_637 140
19 3300046663 Ga0495635_0020681 Ga0495635_0020681_1364_1786 140
20 3300053085 Ga0495619_0002691 Ga0495619_0002691_10077_10499 140
21 3300049741 Ga0501079_0600054 Ga0501079_0600054_231_656 141
22 3300005356 Ga0070674_101514822 Ga0070674_1015148221 142
23 3300013297 Ga0157378_10032970 Ga0157378_100329705 142
24 3300005578 Ga0068854_100000133 Ga0068854_10000013358 143
25 3300005834 Ga0068851_10518766 Ga0068851_105187662 143
26 3300025321 Ga0207656_10003210 Ga0207656_100032108 143
27 3300025935 Ga0207709_10013078 Ga0207709_100130784 143
28 3300025937 Ga0207669_10144516 Ga0207669_101445162 143
29 3300025981 Ga0207640_10000147 Ga0207640_1000014757 143
30 3300048913 Ga0496110_0000281 Ga0496110_0000281_27381_27812 143
31 3300048914 Ga0496111_0000037 Ga0496111_0000037_49177_49608 143
32 3300005354 Ga0070675_101232026 Ga0070675_1012320261 144
33 3300005981 Ga0081538_10190231 Ga0081538_101902312 144
34 3300006058 Ga0075432_10054992 Ga0075432_100549922 144
35 3300025926 Ga0207659_10993041 Ga0207659_109930412 144
36 3300025944 Ga0207661_11029295 Ga0207661_110292951 144
37 3300026116 Ga0207674_10444991 Ga0207674_104449912 144
38 3300037418 Ga0395900_0277623 Ga0395900_0277623_73_510 144
39 3300046477 Ga0495664_0780378 Ga0495664_0780378_87_521 144
40 3300046678 Ga0495599_0191283 Ga0495599_0191283_272_706 144
41 3300046680 Ga0495646_0251757 Ga0495646_0251757_33_467 144
42 3300048913 Ga0496110_0079185 Ga0496110_0079185_937_1371 144
43 3300048914 Ga0496111_0021032 Ga0496111_0021032_3424_3858 144
44 3300048915 Ga0496112_0788389 Ga0496112_0788389_219_653 144
45 3300050491 nmdc:mga00v17_369112_c1 nmdc:mga00v17_369112_c1_269_706 144
46 3300053078 Ga0495612_0063197 Ga0495612_0063197_1003_1437 144
47 3300005983 Ga0081540_1063109 Ga0081540_10631092 145
48 3300046457 Ga0495590_0255998 Ga0495590_0255998_197_637 146
49 3300049583 Ga0501067_0041882 Ga0501067_0041882_656_1096 146
50 3300049585 Ga0501069_0120640 Ga0501069_0120640_920_1360 146
51 3300006051 Ga0075364_10085620 Ga0075364_100856202 148
52 3300009148 Ga0105243_10558339 Ga0105243_105583393 148
53 3300010375 Ga0105239_11255744 Ga0105239_112557442 148
54 3300041486 Ga0451807_2310402 Ga0451807_2310402_101_550 148
55 3300048909 Ga0496106_0191374 Ga0496106_0191374_18_464 148
56 3300048914 Ga0496111_0027775 Ga0496111_0027775_1657_2103 148
57 3300048914 Ga0496111_0721991 Ga0496111_0721991_233_679 148
58 3300050491 nmdc:mga00v17_197427_c1 nmdc:mga00v17_197427_c1_461_907 148
59 3300005340 Ga0070689_100728532 Ga0070689_1007285322 149
60 3300005366 Ga0070659_100025318 Ga0070659_1000253184 149
61 3300005439 Ga0070711_100037347 Ga0070711_1000373471 149
62 3300005444 Ga0070694_100371753 Ga0070694_1003717532 149
63 3300005549 Ga0070704_100919399 Ga0070704_1009193991 149
64 3300005614 Ga0068856_100008918 Ga0068856_10000891814 149
65 3300006175 Ga0070712_100014345 Ga0070712_1000143455 149
66 3300009098 Ga0105245_10042735 Ga0105245_100427352 149
67 3300010375 Ga0105239_10464655 Ga0105239_104646552 149
68 3300013307 Ga0157372_10000239 Ga0157372_1000023950 149
69 3300014969 Ga0157376_10017052 Ga0157376_100170524 149
70 3300025915 Ga0207693_10003015 Ga0207693_100030157 149
71 3300025916 Ga0207663_10286065 Ga0207663_102860653 149
72 3300025927 Ga0207687_10021722 Ga0207687_100217223 149
73 3300025928 Ga0207700_10000019 Ga0207700_10000019112 149
74 3300025932 Ga0207690_10034476 Ga0207690_100344763 149
75 3300025936 Ga0207670_10604481 Ga0207670_106044812 149
76 3300026078 Ga0207702_10000326 Ga0207702_1000032640 149
77 3300035398 Ga0316574_0221629 Ga0316574_0221629_279_728 149
78 3300044694 Ga0466963_0008793 Ga0466963_0008793_4789_5238 149
79 3300044842 Ga0466957_0054874 Ga0466957_0054874_1623_2072 149
80 3300045836 Ga0466958_0034335 Ga0466958_0034335_1311_1781 149
81 3300045976 Ga0466967_2222111 Ga0466967_2222111_85_534 149
82 3300046476 Ga0495662_0002846 Ga0495662_0002846_6334_6783 149
83 3300046511 Ga0495608_0000042 Ga0495608_0000042_33442_33891 149
84 3300046675 Ga0495657_0000040 Ga0495657_0000040_33442_33891 149
85 3300046689 Ga0495613_0000324 Ga0495613_0000324_11273_11722 149
86 3300046809 Ga0495600_0072436 Ga0495600_0072436_1107_1556 149
87 3300047317 Ga0495604_0001593 Ga0495604_0001593_16985_17434 149
88 3300047444 Ga0495675_0000051 Ga0495675_0000051_33414_33863 149
89 3300048088 Ga0495602_0000038 Ga0495602_0000038_84265_84714 149
90 3300048915 Ga0496112_0004100 Ga0496112_0004100_3247_3696 149
91 3300048916 Ga0496113_0000002 Ga0496113_0000002_110785_111234 149
92 3300053077 Ga0495601_0000019 Ga0495601_0000019_122318_122767 149
93 3300053084 Ga0495595_0000009 Ga0495595_0000009_159149_159598 149
94 3300053084 Ga0495595_0011855 Ga0495595_0011855_2942_3391 149
95 3300053085 Ga0495619_0000057 Ga0495619_0000057_82008_82457 149
96 3300053085 Ga0495619_0000069 Ga0495619_0000069_2885_3334 149
97 3300005615 Ga0070702_100178478 Ga0070702_1001784782 150
98 3300005618 Ga0068864_100000023 Ga0068864_100000023134 150
99 3300005718 Ga0068866_10000563 Ga0068866_1000056311 150
100 3300005985 Ga0081539_10003837 Ga0081539_100038377 150
101 3300009176 Ga0105242_10022019 Ga0105242_100220196 150
102 3300025899 Ga0207642_10000038 Ga0207642_1000003834 150
103 3300025937 Ga0207669_10000010 Ga0207669_1000001010 150
104 3300026095 Ga0207676_10000025 Ga0207676_10000025144 150
105 3300046615 Ga0495656_0025103 Ga0495656_0025103_519_971 150
106 3300046660 Ga0495625_0004612 Ga0495625_0004612_7757_8209 150
107 3300046681 Ga0495647_0127397 Ga0495647_0127397_81_533 150
108 3300049578 Ga0501042_0607233 Ga0501042_0607233_324_776 150
109 3300050515 nmdc:mga0a205_13717_c1 nmdc:mga0a205_13717_c1_4281_4736 151
110 3300005840 Ga0068870_10132894 Ga0068870_101328942 153
111 3300025908 Ga0207643_10034230 Ga0207643_100342304 153
112 3300005435 Ga0070714_100730125 Ga0070714_1007301251 155
113 3300005466 Ga0070685_10000058 Ga0070685_1000005830 155
114 3300005614 Ga0068856_100126160 Ga0068856_1001261601 155
115 3300006881 Ga0068865_100000024 Ga0068865_10000002433 155
116 3300009098 Ga0105245_10022144 Ga0105245_100221447 155
117 3300009177 Ga0105248_10000017 Ga0105248_1000001756 155
118 3300025927 Ga0207687_10000025 Ga0207687_1000002588 155
119 3300025934 Ga0207686_10346043 Ga0207686_103460432 155
120 3300025938 Ga0207704_10000054 Ga0207704_1000005448 155
121 3300025941 Ga0207711_10000011 Ga0207711_10000011103 155
122 3300026078 Ga0207702_10344695 Ga0207702_103446951 155
123 3300045976 Ga0466967_0000272 Ga0466967_0000272_14140_14610 155
124 3300003659 JGI25404J52841_10124302 JGI25404J52841_101243021 160
125 3300005983 Ga0081540_1007329 Ga0081540_10073293 160
126 3300006051 Ga0075364_10105782 Ga0075364_101057821 160
127 3300037466 Ga0395898_0051321 Ga0395898_0051321_2805_3287 160
128 3300037466 Ga0395898_0355908 Ga0395898_0355908_549_1031 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

8

102

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.9086 2 111
7epn-assembly1.cif.gz_B ketosteroid isomerase ksi native 0.8974 1 113
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8815 5 118
7epn-assembly1.cif.gz_A ketosteroid isomerase ksi native 0.8802 1 113
1e3r-assembly1.cif.gz_A crystal structure of ketosteroid isomerase mutant d40n (d38n ti numbering) from pseudomonas putida complexed with androsten-3beta-ol-17-one 0.8787 5 113
ID Description Score Start End Superfamily
4ggtA00 Mainly Beta;Beta Barrel;Lipocalin;Avidin-like 0.9044 66 99 2.40.128.30
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8982 2 111 3.10.450.50
2bngA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8769 4 113 3.10.450.50
af_O33283_1_149_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8714 5 113 3.10.450.50
4r9lC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8582 5 113 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A5K7YIB6-F1-model_v4 SnoaL-like domain-containing protein 0.9552 58 112 GO:0030638
AF-A0A2W4X5P1-F1-model_v4 SnoaL-like domain-containing protein 0.9139 4 122
AF-A0A4V3DUM0-F1-model_v4 deleted 0.9108 4 112
AF-W4MCA9-F1-model_v4 SnoaL-like domain-containing protein 0.9092 1 113
AF-A0A1Y5KXT3-F1-model_v4 SnoaL-like domain-containing protein 0.9087 1 115

Feature Viewer

pLDDT pTM Quality
79.73 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map