F136648

General Info

Members Datasets Scaffolds Average Seq Length
128 110 256 265

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10443361|Ga0070658_104433612
Length 267
Sequence MKAVILCGGKGTRLREETEFRPKPMVEVGGRPILWHIMKLYSHYGFDDFVLCLGYKGAMIKEYFLNYHSMTNDCAVTIGHQARPAVDYLNEVADHFTVTLADTGPDTMTGGRLKRVERYIDDDTFMLTYGDGLSDVNIPELLAFHQAHGKLATVTAIQPSSRFGLLDITDDGAVEQFREKPVADEWINGGFFVFNRGIFDYLDSECTLEQEPLMNLANNGQLMAYRHTGFWHAMDIYRDTLHLNDLWARDEAPWAIWQGVTLKALAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
48 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
76 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
108 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
109 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 0.78
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 23.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10443361 3300005327 Bacteria 1118
2 2214792442 2209111006 Unclassified 2178
3 JGI24033J26618_1000151 3300002155 Bacteria 8837
4 rootL2_10026863 3300003322 Bacteria 17359
5 rootH1_10003919 3300003323 Bacteria 52303
6 Ga0055530_10009754 3300003791 Bacteria 3639
7 Ga0065704_10087004 3300005289 Bacteria 3065
8 Ga0065715_10118355 3300005293 Unclassified 2318
9 Ga0070683_100122571 3300005329 Bacteria 2456
10 Ga0070689_100305638 3300005340 Bacteria 1325
11 Ga0070661_100000538 3300005344 Bacteria 29013
12 Ga0070659_100037372 3300005366 Bacteria 3785
13 Ga0070711_100293295 3300005439 Unclassified 1291
14 Ga0070705_100011117 3300005440 Unclassified 4529
15 Ga0070678_100012449 3300005456 Bacteria 5289
16 Ga0070707_100181510 3300005468 Bacteria 2052
17 Ga0070697_100178486 3300005536 Bacteria 1799
18 Ga0070665_100518038 3300005548 Bacteria 1204
19 Ga0068856_100000914 3300005614 Bacteria 31577
20 Ga0068863_100232886 3300005841 Bacteria 1777
21 Ga0068862_100595693 3300005844 Bacteria 1061
22 Ga0081455_10003245 3300005937 Bacteria 18830
23 Ga0081455_10067689 3300005937 Bacteria 2975
24 Ga0070717_10000016 3300006028 Bacteria 205932
25 Ga0070717_10005068 3300006028 Bacteria 9605
26 Ga0075364_10048914 3300006051 Bacteria 2756
27 Ga0068871_100255254 3300006358 Bacteria 1528
28 Ga0075434_100272671 3300006871 Unclassified 1711
29 Ga0114129_10005524 3300009147 Bacteria 17883
30 Ga0157374_10058289 3300013296 Bacteria 3608
31 Ga0157378_10001118 3300013297 Bacteria 24448
32 Ga0157372_10105044 3300013307 Bacteria 3230
33 Ga0157372_10386458 3300013307 Bacteria 1631
34 Ga0157375_10003239 3300013308 Bacteria 14128
35 Ga0213875_10017009 3300021388 Unclassified 3521
36 Ga0209050_1000587 3300025298 Bacteria 58345
37 Ga0207705_10270180 3300025909 Bacteria 1300
38 Ga0207693_10033527 3300025915 Unclassified 4053
39 Ga0207663_10170877 3300025916 Unclassified 1544
40 Ga0207649_10000278 3300025920 Bacteria 40413
41 Ga0207646_10158971 3300025922 Bacteria 2039
42 Ga0207644_10304003 3300025931 Bacteria 1286
43 Ga0207690_10009239 3300025932 Bacteria 5854
44 Ga0207702_10002010 3300026078 Bacteria 19713
45 Ga0207641_10384208 3300026088 Bacteria 1345
46 Ga0207683_10023395 3300026121 Bacteria 5315
47 Ga0268265_10089295 3300028380 Bacteria 2458
48 Ga0265319_1014259 3300028563 Bacteria 3124
49 Ga0265319_1018967 3300028563 Bacteria 2578
50 Ga0265338_10000943 3300028800 Bacteria 49004
51 Ga0265338_10275327 3300028800 Bacteria 1232
52 Ga0265324_10000259 3300029957 Bacteria 39278
53 Ga0265324_10008818 3300029957 Bacteria 3975
54 Ga0265320_10050521 3300031240 Bacteria 2020
55 Ga0265320_10196718 3300031240 Bacteria 900
56 Ga0265325_10021624 3300031241 Bacteria 3531
57 Ga0265339_10041211 3300031249 Bacteria 2564
58 Ga0265327_10000032 3300031251 Bacteria 318763
59 Ga0265327_10002571 3300031251 Bacteria 18783
60 Ga0307508_10000229 3300031616 Bacteria 68303
61 Ga0265314_10059256 3300031711 Bacteria 2620
62 Ga0373955_0181463 3300035172 Bacteria 1249
63 Ga0373935_0236769 3300035692 Unclassified 1273
64 Ga0373927_0090448 3300035695 Bacteria 1988
65 Ga0373927_0195051 3300035695 Bacteria 1329
66 Ga0373933_0086600 3300035724 Bacteria 1928
67 Ga0373933_0454416 3300035724 Bacteria 838
68 Ga0395899_0000015 3300037312 Bacteria 470061
69 Ga0395898_0000051 3300037466 Bacteria 281872
70 Ga0436364_0945183 3300037853 Bacteria 15972
71 Ga0451800_0609686 3300041459 Bacteria 1098
72 Ga0453683_0000308 3300044673 Bacteria 61510
73 Ga0453683_0081430 3300044673 Bacteria 2028
74 Ga0466966_0063012 3300044684 Bacteria 2337
75 Ga0453684_0123256 3300044712 Bacteria 3125
76 Ga0453684_0264159 3300044712 Unclassified 1970
77 Ga0466957_0076657 3300044842 Unclassified 2076
78 Ga0451576_0004753 3300045051 Bacteria 17438
79 Ga0451576_0010397 3300045051 Bacteria 10683
80 Ga0451576_0061817 3300045051 Bacteria 3906
81 Ga0495592_0091895 3300046454 Unclassified 2176
82 Ga0495629_0205736 3300046459 Unclassified 1360
83 Ga0495641_0044878 3300046461 Bacteria 2037
84 Ga0495653_0108484 3300046463 Bacteria 1999
85 Ga0495582_0023536 3300046473 Unclassified 3369
86 Ga0495639_0045069 3300046475 Unclassified 1995
87 Ga0495594_0161659 3300046499 Unclassified 1273
88 Ga0495608_0470515 3300046511 Bacteria 763
89 Ga0495618_0175376 3300046514 Bacteria 1363
90 Ga0495628_0066724 3300046516 Bacteria 2812
91 Ga0495666_0075406 3300046526 Unclassified 1599
92 Ga0495665_0157089 3300046531 Unclassified 1186
93 Ga0495640_0182385 3300046533 Unclassified 1337
94 Ga0495645_0145627 3300046543 Unclassified 1650
95 Ga0495645_0263801 3300046543 Bacteria 1139
96 Ga0495645_0397470 3300046543 Bacteria 879
97 Ga0495667_0090359 3300046559 Unclassified 1984
98 Ga0495635_0030248 3300046663 Unclassified 3763
99 Ga0495657_0091846 3300046675 Bacteria 1946
100 Ga0495646_0123004 3300046680 Bacteria 1467
101 Ga0495658_0074836 3300046683 Unclassified 1974
102 Ga0495613_0322241 3300046689 Bacteria 1066
103 Ga0495624_0023592 3300046690 Unclassified 4056
104 Ga0495624_0066208 3300046690 Bacteria 2256
105 Ga0495600_0243116 3300046809 Unclassified 1146
106 Ga0495600_0420148 3300046809 Bacteria 830
107 Ga0495674_0040082 3300047319 Unclassified 4192
108 Ga0495676_0040243 3300047321 Unclassified 3860
109 Ga0495680_0073069 3300047322 Unclassified 2607
110 Ga0495684_0065102 3300047471 Unclassified 2771
111 Ga0501031_0048582 3300049568 Bacteria 2765
112 Ga0501033_0000058 3300049570 Bacteria 107337
113 Ga0501034_0033233 3300049571 Bacteria 5235
114 Ga0501036_0038073 3300049572 Bacteria 4069
115 Ga0501037_0000175 3300049573 Bacteria 60682
116 Ga0501038_0009970 3300049574 Bacteria 8698
117 Ga0501039_0007360 3300049575 Bacteria 8392
118 Ga0501043_0000786 3300049579 Bacteria 28245
119 Ga0501047_0102175 3300049581 Bacteria 2746
120 Ga0501070_0003465 3300049586 Bacteria 13685
121 Ga0501035_0000001 3300049822 Bacteria 1037138
122 Ga0501044_0000866 3300049823 Bacteria 36444
123 nmdc:mga00v17_25065_c1 3300050491 Unclassified 3463
124 nmdc:mga05p37_5270_c1 3300050507 Bacteria 15176
125 Ga0500650_0093367 3300053098 Bacteria 1408
126 Ga0500555_000014 3300053103 Bacteria 233611
127 Ga0500642_0025446 3300053130 Bacteria 2404
128 Ga0500616_0004594 3300053153 Bacteria 9762
129 Ga0070658_10443361
130 2214792442
131 JGI24033J26618_1000151
132 rootL2_10026863
133 rootH1_10003919
134 Ga0055530_10009754
135 Ga0065704_10087004
136 Ga0065715_10118355
137 Ga0070683_100122571
138 Ga0070689_100305638
139 Ga0070661_100000538
140 Ga0070659_100037372
141 Ga0070711_100293295
142 Ga0070705_100011117
143 Ga0070678_100012449
144 Ga0070707_100181510
145 Ga0070697_100178486
146 Ga0070665_100518038
147 Ga0068856_100000914
148 Ga0068863_100232886
149 Ga0068862_100595693
150 Ga0081455_10003245
151 Ga0081455_10067689
152 Ga0070717_10000016
153 Ga0070717_10005068
154 Ga0075364_10048914
155 Ga0068871_100255254
156 Ga0075434_100272671
157 Ga0114129_10005524
158 Ga0157374_10058289
159 Ga0157378_10001118
160 Ga0157372_10105044
161 Ga0157372_10386458
162 Ga0157375_10003239
163 Ga0213875_10017009
164 Ga0209050_1000587
165 Ga0207705_10270180
166 Ga0207693_10033527
167 Ga0207663_10170877
168 Ga0207649_10000278
169 Ga0207646_10158971
170 Ga0207644_10304003
171 Ga0207690_10009239
172 Ga0207702_10002010
173 Ga0207641_10384208
174 Ga0207683_10023395
175 Ga0268265_10089295
176 Ga0265319_1014259
177 Ga0265319_1018967
178 Ga0265338_10000943
179 Ga0265338_10275327
180 Ga0265324_10000259
181 Ga0265324_10008818
182 Ga0265320_10050521
183 Ga0265320_10196718
184 Ga0265325_10021624
185 Ga0265339_10041211
186 Ga0265327_10000032
187 Ga0265327_10002571
188 Ga0307508_10000229
189 Ga0265314_10059256
190 Ga0373955_0181463
191 Ga0373935_0236769
192 Ga0373927_0090448
193 Ga0373927_0195051
194 Ga0373933_0086600
195 Ga0373933_0454416
196 Ga0395899_0000015
197 Ga0395898_0000051
198 Ga0436364_0945183
199 Ga0451800_0609686
200 Ga0453683_0000308
201 Ga0453683_0081430
202 Ga0466966_0063012
203 Ga0453684_0123256
204 Ga0453684_0264159
205 Ga0466957_0076657
206 Ga0451576_0004753
207 Ga0451576_0010397
208 Ga0451576_0061817
209 Ga0495592_0091895
210 Ga0495629_0205736
211 Ga0495641_0044878
212 Ga0495653_0108484
213 Ga0495582_0023536
214 Ga0495639_0045069
215 Ga0495594_0161659
216 Ga0495608_0470515
217 Ga0495618_0175376
218 Ga0495628_0066724
219 Ga0495666_0075406
220 Ga0495665_0157089
221 Ga0495640_0182385
222 Ga0495645_0145627
223 Ga0495645_0263801
224 Ga0495645_0397470
225 Ga0495667_0090359
226 Ga0495635_0030248
227 Ga0495657_0091846
228 Ga0495646_0123004
229 Ga0495658_0074836
230 Ga0495613_0322241
231 Ga0495624_0023592
232 Ga0495624_0066208
233 Ga0495600_0243116
234 Ga0495600_0420148
235 Ga0495674_0040082
236 Ga0495676_0040243
237 Ga0495680_0073069
238 Ga0495684_0065102
239 Ga0501031_0048582
240 Ga0501033_0000058
241 Ga0501034_0033233
242 Ga0501036_0038073
243 Ga0501037_0000175
244 Ga0501038_0009970
245 Ga0501039_0007360
246 Ga0501043_0000786
247 Ga0501047_0102175
248 Ga0501070_0003465
249 Ga0501035_0000001
250 Ga0501044_0000866
251 nmdc:mga00v17_25065_c1
252 nmdc:mga05p37_5270_c1
253 Ga0500650_0093367
254 Ga0500555_000014
255 Ga0500642_0025446
256 Ga0500616_0004594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

248

0.83

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

156

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8989 2 261
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8886 2 261
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8857 2 261
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8761 1 254
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.872 2 261
ID Description Score Start End Superfamily
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8965 2 253 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8857 2 261 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.872 2 261 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8717 2 253 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8706 1 251 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A383BKH4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9665 1 150 GO:0009058
GO:0047343
AF-A0A850KEP1-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9625 1 150 GO:0009058
GO:0047343
AF-A0A7X7BYB0-F1-model_v4 NTP transferase domain-containing protein 0.9591 1 129 GO:0009058
GO:0047343
AF-A0A350JKJ1-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9569 1 136 GO:0009058
GO:0047343
AF-A0A382RYG7-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.954 1 138 GO:0009058
GO:0047343

Map