F136142

General Info

Members Datasets Scaffolds Average Seq Length
127 112 252 283

Family's Representative Sequence

Representative Sequence 3300059660|Ga0587124_004263|Ga0587124_004263_23_970
Length 315
Sequence MKRLFIATALMAAMLVPASQALASSHHPTGEFTSFGECPLSHPTVELCFFSETSSGFFQIGKKNVPLKNPVILQGGLEEGAGGEAVFVAAENGETLSKTPQTVPGGLLGVEAPKSWPLFLQILFNETINKGLTGVTATVELAGPASAIKINSENLLEETGTALSLPTKIKLSNAFLGNNCYIGSNSHPVVIDFTSGETSPPPPNKPIHGSAGTLTIGAQGVITISGGSLVNNSFAAPGANGCGGLFSFLVDPFVNSLVGLPSPAGNNAAVLEGKIQLAPATFVKASFVLWLGQLNVVSVREWSAAGDPSFVSSRF

Samples

Sample ID Description Type Environment
1 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
27 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
28 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
29 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
83 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
84 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
85 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
86 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.65
Metatranscriptomes 28.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.3
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 27.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587124_004263 3300059660 Bacteria 1097
2 JGI24742J22300_10001813 3300002244 Bacteria 3399
3 JGI24751J29686_10038153 3300002459 Unclassified 995
4 Ga0070666_10061890 3300005335 Bacteria 2535
5 Ga0068868_100000008 3300005338 Bacteria 121926
6 Ga0070692_10082225 3300005345 Bacteria 1736
7 Ga0070675_100000036 3300005354 Bacteria 85959
8 Ga0070674_100000063 3300005356 Bacteria 47714
9 Ga0070673_100052330 3300005364 Bacteria 3203
10 Ga0070688_100061554 3300005365 Unclassified 2373
11 Ga0070711_100017437 3300005439 Bacteria 4573
12 Ga0070678_100101129 3300005456 Unclassified 2234
13 Ga0070662_100000038 3300005457 Bacteria 75003
14 Ga0068867_100000127 3300005459 Bacteria 49103
15 Ga0070693_100016404 3300005547 Bacteria 3834
16 Ga0068856_100001747 3300005614 Bacteria 22703
17 Ga0068864_100000015 3300005618 Bacteria 303368
18 Ga0068866_10000011 3300005718 Bacteria 97191
19 Ga0068860_100003122 3300005843 Bacteria 17119
20 Ga0070715_10000011 3300006163 Bacteria 183857
21 Ga0070712_100000978 3300006175 Bacteria 17209
22 Ga0075433_10012640 3300006852 Bacteria 6830
23 Ga0068865_100000438 3300006881 Bacteria 23094
24 Ga0105245_10004470 3300009098 Bacteria 12360
25 Ga0105245_10051121 3300009098 Bacteria 3705
26 Ga0105243_10007363 3300009148 Bacteria 8463
27 Ga0130087_1101525 3300009828 Bacteria 953
28 Ga0130086_1060335 3300009829 Bacteria 953
29 Ga0130084_1085750 3300009835 Bacteria 953
30 Ga0130085_1103132 3300009850 Bacteria 953
31 Ga0157371_10013885 3300013102 Bacteria 6100
32 Ga0157370_10060369 3300013104 Bacteria 3600
33 Ga0157378_10001730 3300013297 Bacteria 19610
34 Ga0157378_10051122 3300013297 Bacteria 3677
35 Ga0157372_10008183 3300013307 Bacteria 11117
36 Ga0157379_10088200 3300014968 Bacteria 2782
37 Ga0163161_10000018 3300017792 Bacteria 228801
38 Ga0184599_120988 3300019188 Unclassified 1014
39 Ga0154015_1577299 3300020610 Unclassified 1022
40 Ga0207642_10000010 3300025899 Bacteria 99207
41 Ga0207680_10050981 3300025903 Bacteria 2473
42 Ga0207685_10000001 3300025905 Bacteria 604473
43 Ga0207693_10064325 3300025915 Bacteria 2873
44 Ga0207663_10013368 3300025916 Bacteria 4460
45 Ga0207659_10000013 3300025926 Bacteria 172742
46 Ga0207687_10002485 3300025927 Bacteria 12525
47 Ga0207687_10011202 3300025927 Bacteria 5856
48 Ga0207706_10000026 3300025933 Bacteria 149379
49 Ga0207669_10000025 3300025937 Bacteria 93633
50 Ga0207704_10000608 3300025938 Bacteria 15827
51 Ga0207651_10016679 3300025960 Bacteria 4312
52 Ga0207677_10000751 3300026023 Bacteria 18691
53 Ga0207702_10000076 3300026078 Bacteria 112300
54 Ga0207648_10008053 3300026089 Bacteria 10267
55 Ga0207676_10000018 3300026095 Bacteria 306375
56 Ga0268264_10003026 3300028381 Bacteria 14577
57 Ga0466967_0000001 3300045976 Bacteria 229823
58 Ga0495592_0000428 3300046454 Bacteria 31801
59 Ga0495629_0000106 3300046459 Bacteria 74178
60 Ga0495653_0122920 3300046463 Bacteria 1846
61 Ga0495653_0160923 3300046463 Bacteria 1558
62 Ga0495662_0000250 3300046476 Bacteria 22726
63 Ga0495606_0000040 3300046507 Bacteria 223500
64 Ga0495608_0000007 3300046511 Bacteria 313495
65 Ga0495608_0001459 3300046511 Bacteria 16807
66 Ga0495618_0000075 3300046514 Bacteria 70236
67 Ga0495628_0015935 3300046516 Bacteria 6272
68 Ga0495628_0017459 3300046516 Bacteria 5974
69 Ga0495630_0003783 3300046517 Bacteria 10553
70 Ga0495640_0038457 3300046533 Bacteria 3365
71 Ga0495634_0088213 3300046642 Bacteria 2018
72 Ga0495635_0000096 3300046663 Bacteria 52204
73 Ga0495657_0000001 3300046675 Bacteria 445641
74 Ga0495657_0005385 3300046675 Bacteria 10121
75 Ga0495613_0000157 3300046689 Bacteria 66401
76 Ga0495613_0120047 3300046689 Unclassified 1888
77 Ga0495624_0004399 3300046690 Bacteria 10309
78 Ga0495670_0015765 3300046691 Bacteria 3716
79 Ga0495600_0000884 3300046809 Bacteria 16029
80 Ga0495672_0141661 3300047320 Unclassified 1255
81 Ga0495680_0000952 3300047322 Bacteria 32176
82 Ga0495675_0000017 3300047444 Bacteria 123394
83 Ga0495685_007433 3300047447 Bacteria 3617
84 Ga0496108_0000063 3300048911 Bacteria 118950
85 Ga0496109_0000012 3300048912 Bacteria 229699
86 Ga0496110_0000010 3300048913 Bacteria 102630
87 Ga0496110_0045518 3300048913 Bacteria 3836
88 Ga0496111_0002452 3300048914 Bacteria 11197
89 Ga0496111_0364382 3300048914 Bacteria 1069
90 Ga0496112_0002947 3300048915 Bacteria 13879
91 Ga0496113_0000099 3300048916 Bacteria 36270
92 nmdc:mga0a205_914_c1 3300050515 Bacteria 24312
93 Ga0495655_0013251 3300053083 Bacteria 1701
94 Ga0495595_0000002 3300053084 Bacteria 445641
95 Ga0495595_0000443 3300053084 Bacteria 15701
96 Ga0495619_0000053 3300053085 Bacteria 98761
97 Ga0495619_0101957 3300053085 Bacteria 1954
98 Ga0587084_018863 3300059477 Unclassified 1010
99 Ga0587093_013737 3300059478 Unclassified 1000
100 Ga0587066_023929 3300059490 Unclassified 1035
101 Ga0587066_034185 3300059490 Unclassified 924
102 Ga0587070_027942 3300059491 Unclassified 1003
103 Ga0587085_015630 3300059506 Unclassified 1087
104 Ga0587086_014260 3300059507 Unclassified 1012
105 Ga0587088_026931 3300059508 Unclassified 1001
106 Ga0587089_015124 3300059509 Unclassified 1015
107 Ga0587090_022256 3300059510 Unclassified 1000
108 Ga0587091_025657 3300059511 Unclassified 1067
109 Ga0587092_010911 3300059512 Unclassified 1253
110 Ga0587094_016059 3300059513 Unclassified 1039
111 Ga0587131_002551 3300059609 Unclassified 996
112 Ga0587101_016785 3300059623 Unclassified 1007
113 Ga0587109_032198 3300059624 Unclassified 1001
114 Ga0587115_013071 3300059626 Bacteria 1070
115 Ga0587115_015910 3300059626 Unclassified 1000
116 Ga0587117_015359 3300059627 Unclassified 1005
117 Ga0587127_003487 3300059629 Unclassified 1001
118 Ga0587128_013842 3300059630 Unclassified 1145
119 Ga0587130_007710 3300059631 Unclassified 1008
120 Ga0587062_016572 3300059639 Unclassified 998
121 Ga0587100_003600 3300059648 Unclassified 1071
122 Ga0587102_008018 3300059649 Unclassified 996
123 Ga0587108_004777 3300059653 Unclassified 1001
124 Ga0587119_012172 3300059658 Unclassified 1001
125 Ga0587071_033499 3300060344 Unclassified 1000
126 Ga0587111_0028744 3300060346 Unclassified 1122
127 Ga0587124_004263
128 JGI24742J22300_10001813
129 JGI24751J29686_10038153
130 Ga0070666_10061890
131 Ga0068868_100000008
132 Ga0070692_10082225
133 Ga0070675_100000036
134 Ga0070674_100000063
135 Ga0070673_100052330
136 Ga0070688_100061554
137 Ga0070711_100017437
138 Ga0070678_100101129
139 Ga0070662_100000038
140 Ga0068867_100000127
141 Ga0070693_100016404
142 Ga0068856_100001747
143 Ga0068864_100000015
144 Ga0068866_10000011
145 Ga0068860_100003122
146 Ga0070715_10000011
147 Ga0070712_100000978
148 Ga0075433_10012640
149 Ga0068865_100000438
150 Ga0105245_10004470
151 Ga0105245_10051121
152 Ga0105243_10007363
153 Ga0130087_1101525
154 Ga0130086_1060335
155 Ga0130084_1085750
156 Ga0130085_1103132
157 Ga0157371_10013885
158 Ga0157370_10060369
159 Ga0157378_10001730
160 Ga0157378_10051122
161 Ga0157372_10008183
162 Ga0157379_10088200
163 Ga0163161_10000018
164 Ga0184599_120988
165 Ga0154015_1577299
166 Ga0207642_10000010
167 Ga0207680_10050981
168 Ga0207685_10000001
169 Ga0207693_10064325
170 Ga0207663_10013368
171 Ga0207659_10000013
172 Ga0207687_10002485
173 Ga0207687_10011202
174 Ga0207706_10000026
175 Ga0207669_10000025
176 Ga0207704_10000608
177 Ga0207651_10016679
178 Ga0207677_10000751
179 Ga0207702_10000076
180 Ga0207648_10008053
181 Ga0207676_10000018
182 Ga0268264_10003026
183 Ga0466967_0000001
184 Ga0495592_0000428
185 Ga0495629_0000106
186 Ga0495653_0122920
187 Ga0495653_0160923
188 Ga0495662_0000250
189 Ga0495606_0000040
190 Ga0495608_0000007
191 Ga0495608_0001459
192 Ga0495618_0000075
193 Ga0495628_0015935
194 Ga0495628_0017459
195 Ga0495630_0003783
196 Ga0495640_0038457
197 Ga0495634_0088213
198 Ga0495635_0000096
199 Ga0495657_0000001
200 Ga0495657_0005385
201 Ga0495613_0000157
202 Ga0495613_0120047
203 Ga0495624_0004399
204 Ga0495670_0015765
205 Ga0495600_0000884
206 Ga0495672_0141661
207 Ga0495680_0000952
208 Ga0495675_0000017
209 Ga0495685_007433
210 Ga0496108_0000063
211 Ga0496109_0000012
212 Ga0496110_0000010
213 Ga0496110_0045518
214 Ga0496111_0002452
215 Ga0496111_0364382
216 Ga0496112_0002947
217 Ga0496113_0000099
218 nmdc:mga0a205_914_c1
219 Ga0495655_0013251
220 Ga0495595_0000002
221 Ga0495595_0000443
222 Ga0495619_0000053
223 Ga0495619_0101957
224 Ga0587084_018863
225 Ga0587093_013737
226 Ga0587066_023929
227 Ga0587066_034185
228 Ga0587070_027942
229 Ga0587085_015630
230 Ga0587086_014260
231 Ga0587088_026931
232 Ga0587089_015124
233 Ga0587090_022256
234 Ga0587091_025657
235 Ga0587092_010911
236 Ga0587094_016059
237 Ga0587131_002551
238 Ga0587101_016785
239 Ga0587109_032198
240 Ga0587115_013071
241 Ga0587115_015910
242 Ga0587117_015359
243 Ga0587127_003487
244 Ga0587128_013842
245 Ga0587130_007710
246 Ga0587062_016572
247 Ga0587100_003600
248 Ga0587102_008018
249 Ga0587108_004777
250 Ga0587119_012172
251 Ga0587071_033499
252 Ga0587111_0028744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5had-assembly1.cif.gz_A crystal structure of intermembrane space region of chloroplast protein arc6 0.5553 169 216
8gak-assembly1.cif.gz_A crystal structure of e. coli lpta in complex with chinavia ubica thanatin 0.4188 188 216
4a6g-assembly1.cif.gz_A n-acyl amino acid racemase from amycalotopsis sp. ts-1-60: g291d- f323y mutant in complex with n-acetyl methionine 0.3933 44 89
8c29-assembly1.cif.gz_o cryo-em structure of photosystem ii c2s2 supercomplex from norway spruce (picea abies) at 2.8 angstrom resolution 0.3861 44 260
8bss-assembly1.cif.gz_A solution structure of thanatin-like derivative 5 in complex with e. coli lpta mutant q62l 0.3813 184 216
ID Description Score Start End Superfamily
af_Q9FIG9_679_794_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5392 169 216 3.10.450.240
af_Q04006_16_172_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.4858 187 231 3.60.21.10
af_Q8IJD7_310_584_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4602 178 216 2.130.10.10
af_P0AGG8_13_239_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.441 40 87 3.30.2290.10
af_Q68EL2_1_160_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.394 45 83 3.50.80.10
ID Description Score Start End GO Terms
AF-H0EBW5-F1-model_v4 Putative secreted protein 0.8022 54 267
AF-A0A108U965-F1-model_v4 Secreted protein 0.799 35 267
AF-A0A7W1RAX8-F1-model_v4 CHRD domain-containing protein 0.7967 1 266
AF-A0A7W1RAX8-F1-model_v4 CHRD domain-containing protein 0.7852 1 266
AF-A0A1M3BI04-F1-model_v4 Uncharacterized protein 0.7807 73 268

Map