F133902

General Info

Members Datasets Scaffolds Average Seq Length
127 91 254 345

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100365870|Ga0075431_1003658702
Length 369
Sequence MNAKGLNLALQGGGSHGAYSWGVLDRLLDEEDIALHGVSGASAGAMNAVVLANGYRSGGRQGAKAALERFWREVYGLGCLYSPFKSTPLDALMQSWNIDSTVSYQLFELLVRVFSPYQYNPFNLNPLRSLLADQIDWKLINAGGAVPLFITATSVRTGRPRVFRCQQVTTDVVLASACIPFYFQTVEIDGEPYWDGGYMGNPSIWPLIYRTEIKDILLVQINPLTRDETPMQANEIINRLNEISFNSSLIAEMRAIDFVRRLIDENRLDEKKYKRINMHMIPAPALEYRLNASSKLNTDWAFLEFLHDKGWAAADAWIRGNKDAIGVASSIDIAETFLGRHRTASTPPRVEETFRIAKRAPSQAAGKRQ

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
27 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
31 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
40 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
43 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
44 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
59 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
60 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
69 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
70 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
74 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
75 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
76 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
81 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
82 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
83 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
84 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
85 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
87 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
88 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
89 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
90 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
91 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0.79
Isolates 3.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0.79
Rhizoplane 12.6
Rhizosphere 61.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100365870 3300006847 Bacteria 1448
2 JGI25406J46586_10000944 3300003203 Bacteria 13692
3 Ga0070683_100139101 3300005329 Bacteria 2300
4 Ga0070691_10015705 3300005341 Bacteria 3479
5 Ga0070714_100254415 3300005435 Bacteria 1625
6 Ga0070711_100027601 3300005439 Bacteria 3728
7 Ga0070694_100071054 3300005444 Bacteria 2398
8 Ga0070707_100127103 3300005468 Bacteria 2477
9 Ga0070665_100194283 3300005548 Bacteria 2030
10 Ga0068861_100041170 3300005719 Bacteria 3460
11 Ga0068861_100060441 3300005719 Bacteria 2904
12 Ga0068862_100044170 3300005844 Bacteria 3801
13 Ga0081539_10000207 3300005985 Bacteria 136970
14 Ga0075365_10011522 3300006038 Bacteria 5201
15 Ga0075365_10035823 3300006038 Bacteria 3213
16 Ga0075365_10093532 3300006038 Bacteria 2051
17 Ga0075368_10007011 3300006042 Bacteria 3966
18 Ga0070715_10028438 3300006163 Bacteria 2242
19 Ga0070715_10035856 3300006163 Bacteria 2043
20 Ga0075367_10006852 3300006178 Bacteria 5795
21 Ga0075367_10015730 3300006178 Bacteria 4118
22 Ga0075431_100002539 3300006847 Bacteria 17612
23 Ga0075431_100032361 3300006847 Bacteria 5389
24 Ga0075434_100002567 3300006871 Bacteria 16035
25 Ga0075434_100008296 3300006871 Bacteria 9650
26 Ga0075435_100051248 3300007076 Bacteria 3325
27 Ga0114129_10015437 3300009147 Bacteria 10865
28 Ga0114129_10209833 3300009147 Bacteria 2634
29 Ga0114129_10529259 3300009147 Bacteria 1536
30 Ga0105238_10204198 3300009551 Bacteria 1952
31 Ga0105239_10442586 3300010375 Bacteria 1474
32 Ga0157370_10098357 3300013104 Bacteria 2744
33 Ga0163162_10038894 3300013306 Bacteria 4749
34 Ga0163163_10107869 3300014325 Bacteria 2811
35 Ga0157379_10168846 3300014968 Bacteria 1975
36 Ga0213873_10002316 3300021358 Bacteria 3284
37 Ga0213873_10032453 3300021358 Bacteria 1305
38 Ga0213872_10010098 3300021361 Bacteria 4502
39 Ga0213872_10018864 3300021361 Bacteria 3179
40 Ga0213872_10021774 3300021361 Bacteria 2952
41 Ga0213872_10092215 3300021361 Bacteria 1355
42 Ga0213876_10000369 3300021384 Bacteria 38187
43 Ga0213876_10151205 3300021384 Bacteria 1234
44 Ga0213875_10000036 3300021388 Bacteria 166707
45 Ga0213871_10008279 3300021441 Bacteria 2286
46 Ga0209758_1042706 3300025297 Bacteria 1678
47 Ga0207685_10017914 3300025905 Bacteria 2302
48 Ga0207665_10071358 3300025939 Bacteria 2371
49 Ga0207678_10007212 3300026067 Bacteria 9854
50 Ga0207675_100031002 3300026118 Bacteria 4979
51 Ga0207675_100047323 3300026118 Bacteria 4016
52 Ga0209813_10044378 3300027866 Bacteria 1366
53 Ga0268265_10068374 3300028380 Bacteria 2754
54 Ga0265340_10026148 3300031247 Bacteria 2952
55 Ga0265339_10006721 3300031249 Bacteria 7510
56 Ga0307409_100182328 3300031995 Bacteria 1860
57 Ga0307409_100197730 3300031995 Bacteria 1796
58 Ga0373934_0115008 3300035086 Bacteria 1093
59 Ga0373955_0088227 3300035172 Bacteria 1764
60 Ga0373931_0239898 3300035691 Bacteria 1099
61 Ga0372808_008218 3300036459 Bacteria 1443
62 Ga0395899_0086368 3300037312 Bacteria 2279
63 Ga0395900_0094941 3300037418 Bacteria 3064
64 Ga0395898_0028268 3300037466 Bacteria 5623
65 Ga0436364_0245439 3300037853 Bacteria 33775
66 Ga0400485_12897 3300038735 Bacteria 1480
67 Ga0400485_21487 3300038735 Bacteria 1441
68 Ga0400486_15736 3300038742 Bacteria 6931
69 Ga0400486_32500 3300038742 Bacteria 12964
70 Ga0400483_051191 3300039062 Bacteria 33178
71 Ga0436365_0055424 3300039437 Bacteria 1939
72 Ga0436365_0871197 3300039437 Bacteria 18156
73 Ga0436365_1329116 3300039437 Bacteria 1452
74 Ga0436360_0012605 3300039438 Bacteria 5202
75 Ga0436361_0002053 3300039447 Bacteria 2187
76 Ga0436361_0498324 3300039447 Bacteria 3195
77 Ga0436361_0527985 3300039447 Bacteria 23505
78 Ga0436361_0599633 3300039447 Bacteria 1054
79 Ga0436361_1112182 3300039447 Bacteria 4676
80 Ga0436363_0535004 3300039450 Bacteria 3884
81 Ga0436363_1509989 3300039450 Bacteria 1121
82 Ga0436362_0582995 3300039453 Bacteria 8029
83 Ga0436362_0946071 3300039453 Bacteria 3356
84 Ga0495645_0162750 3300046543 Bacteria 1541
85 Ga0495659_0081449 3300046664 Bacteria 1229
86 Ga0495599_0051234 3300046678 Bacteria 2587
87 Ga0496100_0096038 3300048903 Bacteria 2033
88 Ga0496101_0141911 3300048904 Bacteria 1831
89 Ga0496102_0063316 3300048905 Bacteria 3386
90 Ga0496104_0005308 3300048907 Bacteria 11272
91 Ga0496104_0023698 3300048907 Bacteria 5645
92 Ga0496105_0010354 3300048908 Bacteria 7331
93 Ga0496105_0154184 3300048908 Bacteria 1887
94 Ga0496107_0028252 3300048910 Bacteria 3985
95 Ga0496108_0047324 3300048911 Bacteria 3595
96 Ga0496108_0096597 3300048911 Bacteria 2517
97 Ga0496109_0051785 3300048912 Bacteria 3740
98 Ga0496111_0020362 3300048914 Bacteria 4618
99 Ga0496112_0026494 3300048915 Bacteria 5579
100 Ga0496112_0040717 3300048915 Bacteria 4543
101 Ga0496113_0126135 3300048916 Bacteria 2005
102 Ga0496114_0037344 3300048917 Bacteria 4017
103 Ga0501036_0025147 3300049572 Bacteria 5022
104 nmdc:mga03683_123854_c1 3300050489 Bacteria 1151
105 nmdc:mga0yw44_11432_c1 3300050492 Bacteria 4582
106 nmdc:mga0yw44_59011_c1 3300050492 Bacteria 2346
107 nmdc:mga06z11_10508_c1 3300050494 Bacteria 3951
108 nmdc:mga04h51_2877_c1 3300050495 Bacteria 4128
109 nmdc:mga05p37_183643_c1 3300050507 Bacteria 2543
110 nmdc:mga05p37_368861_c1 3300050507 Bacteria 1685
111 nmdc:mga05p37_53654_c1 3300050507 Bacteria 4958
112 nmdc:mga0qj67_9892_c1 3300050509 Bacteria 7110
113 nmdc:mga06r32_142762_c1 3300050510 Bacteria 2371
114 nmdc:mga06r32_210151_c1 3300050510 Bacteria 1934
115 nmdc:mga0n895_289162_c1 3300050512 Bacteria 1662
116 nmdc:mga0n895_559302_c1 3300050512 Bacteria 1149
117 nmdc:mga0rr50_33518_c1 3300050513 Bacteria 3669
118 nmdc:mga08x19_172315_c1 3300050514 Bacteria 1474
119 Ga0495601_0018029 3300053077 Bacteria 4292
120 Ga0495612_0089984 3300053078 Bacteria 1298
121 Ga0500556_0000612 3300053104 Bacteria 22795
122 Ga0500616_0030358 3300053153 Bacteria 2968
123 2509150809 2508501128 Bacteria 8613869
124 2894777269 2894772417 Bacteria 5305674
125 2929205203 2929199973 Bacteria 7260745
126 8055228992 8055225921 Bacteria 3341787
127 8055913382 8055909800 Bacteria 7278581
128 Ga0075431_100365870
129 JGI25406J46586_10000944
130 Ga0070683_100139101
131 Ga0070691_10015705
132 Ga0070714_100254415
133 Ga0070711_100027601
134 Ga0070694_100071054
135 Ga0070707_100127103
136 Ga0070665_100194283
137 Ga0068861_100041170
138 Ga0068861_100060441
139 Ga0068862_100044170
140 Ga0081539_10000207
141 Ga0075365_10011522
142 Ga0075365_10035823
143 Ga0075365_10093532
144 Ga0075368_10007011
145 Ga0070715_10028438
146 Ga0070715_10035856
147 Ga0075367_10006852
148 Ga0075367_10015730
149 Ga0075431_100002539
150 Ga0075431_100032361
151 Ga0075434_100002567
152 Ga0075434_100008296
153 Ga0075435_100051248
154 Ga0114129_10015437
155 Ga0114129_10209833
156 Ga0114129_10529259
157 Ga0105238_10204198
158 Ga0105239_10442586
159 Ga0157370_10098357
160 Ga0163162_10038894
161 Ga0163163_10107869
162 Ga0157379_10168846
163 Ga0213873_10002316
164 Ga0213873_10032453
165 Ga0213872_10010098
166 Ga0213872_10018864
167 Ga0213872_10021774
168 Ga0213872_10092215
169 Ga0213876_10000369
170 Ga0213876_10151205
171 Ga0213875_10000036
172 Ga0213871_10008279
173 Ga0209758_1042706
174 Ga0207685_10017914
175 Ga0207665_10071358
176 Ga0207678_10007212
177 Ga0207675_100031002
178 Ga0207675_100047323
179 Ga0209813_10044378
180 Ga0268265_10068374
181 Ga0265340_10026148
182 Ga0265339_10006721
183 Ga0307409_100182328
184 Ga0307409_100197730
185 Ga0373934_0115008
186 Ga0373955_0088227
187 Ga0373931_0239898
188 Ga0372808_008218
189 Ga0395899_0086368
190 Ga0395900_0094941
191 Ga0395898_0028268
192 Ga0436364_0245439
193 Ga0400485_12897
194 Ga0400485_21487
195 Ga0400486_15736
196 Ga0400486_32500
197 Ga0400483_051191
198 Ga0436365_0055424
199 Ga0436365_0871197
200 Ga0436365_1329116
201 Ga0436360_0012605
202 Ga0436361_0002053
203 Ga0436361_0498324
204 Ga0436361_0527985
205 Ga0436361_0599633
206 Ga0436361_1112182
207 Ga0436363_0535004
208 Ga0436363_1509989
209 Ga0436362_0582995
210 Ga0436362_0946071
211 Ga0495645_0162750
212 Ga0495659_0081449
213 Ga0495599_0051234
214 Ga0496100_0096038
215 Ga0496101_0141911
216 Ga0496102_0063316
217 Ga0496104_0005308
218 Ga0496104_0023698
219 Ga0496105_0010354
220 Ga0496105_0154184
221 Ga0496107_0028252
222 Ga0496108_0047324
223 Ga0496108_0096597
224 Ga0496109_0051785
225 Ga0496111_0020362
226 Ga0496112_0026494
227 Ga0496112_0040717
228 Ga0496113_0126135
229 Ga0496114_0037344
230 Ga0501036_0025147
231 nmdc:mga03683_123854_c1
232 nmdc:mga0yw44_11432_c1
233 nmdc:mga0yw44_59011_c1
234 nmdc:mga06z11_10508_c1
235 nmdc:mga04h51_2877_c1
236 nmdc:mga05p37_183643_c1
237 nmdc:mga05p37_368861_c1
238 nmdc:mga05p37_53654_c1
239 nmdc:mga0qj67_9892_c1
240 nmdc:mga06r32_142762_c1
241 nmdc:mga06r32_210151_c1
242 nmdc:mga0n895_289162_c1
243 nmdc:mga0n895_559302_c1
244 nmdc:mga0rr50_33518_c1
245 nmdc:mga08x19_172315_c1
246 Ga0495601_0018029
247 Ga0495612_0089984
248 Ga0500556_0000612
249 Ga0500616_0030358
250 2509150809
251 2894777269
252 2929205203
253 8055228992
254 8055913382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

8

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8qnd-assembly1.cif.gz_B crystal structure of the ribonucleoside hydrolase c from lactobacillus reuteri 0.7621 27 66
8qnd-assembly1.cif.gz_A crystal structure of the ribonucleoside hydrolase c from lactobacillus reuteri 0.7602 27 66
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.7144 29 345
8oib-assembly1.cif.gz_B trichomonas vaginalis riboside hydrolase in complex with glycerol 0.7089 27 66
8oib-assembly1.cif.gz_C trichomonas vaginalis riboside hydrolase in complex with glycerol 0.7083 27 66
ID Description Score Start End Superfamily
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7182 28 282 3.40.1090.10
af_Q18948_13_218_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6936 29 231 3.40.1090.10
af_B0G109_19_215_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6902 15 237 3.40.1090.10
af_B0G109_19_215_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.681 15 237 3.40.1090.10
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6726 28 66 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519H5R7-F1-model_v4 Patatin-like phospholipase family protein 0.9692 239 362
AF-A0A541C1A2-F1-model_v4 Patatin-like phospholipase family protein 0.9688 22 363 GO:0016042
GO:0016787
AF-A0A2N3AWA0-F1-model_v4 Patatin 0.9671 23 362 GO:0016042
GO:0016787
AF-A0A098RZX1-F1-model_v4 Alpha/beta hydrolase 0.967 27 363 GO:0016042
GO:0016787
AF-A0A3S9ETY4-F1-model_v4 Patatin-like phospholipase family protein 0.9662 20 358 GO:0016042
GO:0016787

Map