F133276

General Info

Members Datasets Scaffolds Average Seq Length
127 100 254 185

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000108|Ga0070709_1000010812
Length 204
Sequence VKVTPTSIPGVVVIEPLVRRDERGFFLETFHRRKFEEHGLPGEFVQDNHSFSTARGILRGMHAQLHHPQGKLVRAVIGEVFDVAVDLRPDSPAFGRWVAEVLSEDNFRQLYVPPGCAHGYLVLSDTSHVEYKCTALYDRPDEIGLAWDDPEVGIQWPESAPLVNERDGAWPRLAELRPLLAPYRGLMARPGTPAGTATAADSIL

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
46 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
59 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
77 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
80 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
81 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
97 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
98 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
99 2818991441 Niallia circulans 3243 Isolate Rhizosphere
100 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 2.36
Rhizosphere 89.76
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10000108 3300005434 Bacteria 57430
2 Ga0055534_1004874 3300003784 Bacteria 3755
3 Ga0070682_100295698 3300005337 Bacteria 1186
4 Ga0070669_100497040 3300005353 Bacteria 1011
5 Ga0070674_100426679 3300005356 Bacteria 1089
6 Ga0070659_100098328 3300005366 Bacteria 2353
7 Ga0070705_100011651 3300005440 Bacteria 4444
8 Ga0070694_100607553 3300005444 Bacteria 881
9 Ga0070708_100024005 3300005445 Bacteria 5192
10 Ga0070708_100848427 3300005445 Bacteria 858
11 Ga0070685_10147916 3300005466 Bacteria 1486
12 Ga0070706_100013213 3300005467 Bacteria 7639
13 Ga0070706_100128256 3300005467 Bacteria 2366
14 Ga0070706_101051725 3300005467 Bacteria 750
15 Ga0070707_100299276 3300005468 Bacteria 1563
16 Ga0070698_100581959 3300005471 Bacteria 1059
17 Ga0070698_100622525 3300005471 Bacteria 1020
18 Ga0070699_100579796 3300005518 Bacteria 1022
19 Ga0070697_100249855 3300005536 Bacteria 1516
20 Ga0070686_100115656 3300005544 Bacteria 1834
21 Ga0070665_100000472 3300005548 Bacteria 58087
22 Ga0070704_100344768 3300005549 Bacteria 1255
23 Ga0068854_100072363 3300005578 Bacteria 2524
24 Ga0068861_100154662 3300005719 Bacteria 1885
25 Ga0068862_100000939 3300005844 Bacteria 28091
26 Ga0070717_10033128 3300006028 Bacteria 4167
27 Ga0075363_100092253 3300006048 Bacteria 1668
28 Ga0075428_100076021 3300006844 Bacteria 3666
29 Ga0075431_100550539 3300006847 Bacteria 1141
30 Ga0075434_100261157 3300006871 Bacteria 1751
31 Ga0075434_100516318 3300006871 Bacteria 1215
32 Ga0075436_100030406 3300006914 Bacteria 3717
33 Ga0099794_10002015 3300007265 Bacteria 7336
34 Ga0111539_10503991 3300009094 Bacteria 1410
35 Ga0114129_10113808 3300009147 Bacteria 3731
36 Ga0114129_10428751 3300009147 Bacteria 1738
37 Ga0114129_11101282 3300009147 Bacteria 994
38 Ga0114129_11388726 3300009147 Bacteria 867
39 Ga0157380_10025555 3300014326 Bacteria 4479
40 Ga0157380_10503711 3300014326 Bacteria 1177
41 Ga0209675_1000389 3300025291 Bacteria 36614
42 Ga0207653_10033747 3300025885 Bacteria 1660
43 Ga0207699_10000292 3300025906 Bacteria 27020
44 Ga0207684_10483204 3300025910 Bacteria 1062
45 Ga0207646_10635135 3300025922 Bacteria 957
46 Ga0207681_10717587 3300025923 Bacteria 832
47 Ga0207690_10342712 3300025932 Bacteria 1180
48 Ga0207706_10186876 3300025933 Bacteria 1819
49 Ga0207665_10062661 3300025939 Bacteria 2524
50 Ga0207675_100175784 3300026118 Bacteria 2048
51 Ga0209588_1003562 3300027671 Bacteria 4325
52 Ga0209588_1028786 3300027671 Bacteria 1770
53 Ga0209971_1016427 3300027682 Bacteria 1755
54 Ga0268265_10001128 3300028380 Bacteria 23591
55 Ga0265332_10009506 3300031238 Bacteria 4339
56 Ga0265328_10064287 3300031239 Bacteria 1348
57 Ga0265339_10001170 3300031249 Bacteria 19816
58 Ga0265313_10089742 3300031595 Bacteria 1382
59 Ga0265314_10000779 3300031711 Bacteria 37875
60 Ga0265342_10052130 3300031712 Unclassified 2439
61 Ga0316576_10339353 3300031727 Bacteria 1119
62 Ga0307415_101034909 3300032126 Bacteria 765
63 Ga0373929_0000001 3300035085 Bacteria 956023
64 Ga0373961_0000789 3300035241 Bacteria 10879
65 Ga0373935_0002916 3300035692 Bacteria 9850
66 Ga0316582_0507129 3300036647 Bacteria 831
67 Ga0436365_0939591 3300039437 Bacteria 1915
68 Ga0451789_1075453 3300041443 Bacteria 1204
69 Ga0451793_0769938 3300041452 Bacteria 916
70 Ga0451577_0006987 3300042876 Bacteria 11150
71 Ga0453683_0024654 3300044673 Bacteria 3824
72 Ga0453684_0484192 3300044712 Bacteria 1372
73 Ga0451576_0315093 3300045051 Bacteria 1637
74 Ga0495638_0273658 3300046460 Bacteria 920
75 Ga0495615_0002772 3300048090 Bacteria 2851
76 Ga0496114_0000025 3300048917 Bacteria 213656
77 Ga0496121_0492577 3300048924 Bacteria 780
78 Ga0496122_0006225 3300048925 Bacteria 13819
79 Ga0496122_0129879 3300048925 Bacteria 1604
80 Ga0496125_0001751 3300048928 Bacteria 30112
81 Ga0501032_0086381 3300049569 Bacteria 2085
82 Ga0501036_0141126 3300049572 Bacteria 2033
83 Ga0501038_0154565 3300049574 Bacteria 1869
84 Ga0501038_0201133 3300049574 Bacteria 1599
85 Ga0501041_0107184 3300049577 Bacteria 1732
86 Ga0501042_0049496 3300049578 Bacteria 2998
87 Ga0501048_0009600 3300049582 Bacteria 7261
88 Ga0501048_0366507 3300049582 Bacteria 1028
89 Ga0501068_0067825 3300049584 Bacteria 2174
90 Ga0501068_0411644 3300049584 Bacteria 872
91 Ga0501071_0024437 3300049587 Bacteria 4228
92 Ga0501071_0917099 3300049587 Bacteria 676
93 Ga0501072_0427817 3300049588 Bacteria 1049
94 Ga0501073_0146042 3300049589 Bacteria 1639
95 Ga0501074_0896968 3300049590 Bacteria 624
96 Ga0501075_0004423 3300049591 Bacteria 9508
97 Ga0501075_0536931 3300049591 Bacteria 892
98 Ga0501076_0020094 3300049592 Bacteria 5109
99 Ga0501076_0022067 3300049592 Bacteria 4889
100 Ga0501076_1205331 3300049592 Bacteria 623
101 Ga0501077_0000284 3300049593 Bacteria 30131
102 Ga0501079_0073129 3300049741 Bacteria 2650
103 Ga0501079_0533018 3300049741 Bacteria 923
104 Ga0501080_0002960 3300049742 Bacteria 14936
105 Ga0501045_0070256 3300049824 Bacteria 2576
106 nmdc:mga05p37_543941_c1 3300050507 Bacteria 1323
107 nmdc:mga05p37_60426_c1 3300050507 Bacteria 4666
108 nmdc:mga05p37_830939_c1 3300050507 Bacteria 1006
109 nmdc:mga05p37_885322_c1 3300050507 Bacteria 965
110 nmdc:mga05p37_929050_c1 3300050507 Bacteria 934
111 nmdc:mga06r32_1387542_c1 3300050510 Bacteria 645
112 nmdc:mga06r32_139638_c1 3300050510 Bacteria 2398
113 nmdc:mga08y16_570431_c1 3300050511 Bacteria 1143
114 nmdc:mga0n895_499748_c1 3300050512 Bacteria 1225
115 nmdc:mga0n895_984956_c1 3300050512 Bacteria 825
116 nmdc:mga08x19_1079_c1 3300050514 Bacteria 17002
117 nmdc:mga0a205_277045_c1 3300050515 Bacteria 1553
118 Ga0501084_0306164 3300054114 Bacteria 1342
119 Ga0590075_107783 3300059424 Bacteria 727
120 Ga0501082_0000011 3300060353 Bacteria 121336
121 Ga0501082_0013558 3300060353 Bacteria 7003
122 Ga0530510_0381569 3300061734 Bacteria 1061
123 Ga0530510_0708010 3300061734 Bacteria 767
124 2595317635 2593339198 Bacteria 7267884
125 2644210900 2643221637 Bacteria 5345260
126 2819566992 2818991441 Bacteria 5062707
127 2937845493 2937843397 Bacteria 5256375
128 Ga0070709_10000108
129 Ga0055534_1004874
130 Ga0070682_100295698
131 Ga0070669_100497040
132 Ga0070674_100426679
133 Ga0070659_100098328
134 Ga0070705_100011651
135 Ga0070694_100607553
136 Ga0070708_100024005
137 Ga0070708_100848427
138 Ga0070685_10147916
139 Ga0070706_100013213
140 Ga0070706_100128256
141 Ga0070706_101051725
142 Ga0070707_100299276
143 Ga0070698_100581959
144 Ga0070698_100622525
145 Ga0070699_100579796
146 Ga0070697_100249855
147 Ga0070686_100115656
148 Ga0070665_100000472
149 Ga0070704_100344768
150 Ga0068854_100072363
151 Ga0068861_100154662
152 Ga0068862_100000939
153 Ga0070717_10033128
154 Ga0075363_100092253
155 Ga0075428_100076021
156 Ga0075431_100550539
157 Ga0075434_100261157
158 Ga0075434_100516318
159 Ga0075436_100030406
160 Ga0099794_10002015
161 Ga0111539_10503991
162 Ga0114129_10113808
163 Ga0114129_10428751
164 Ga0114129_11101282
165 Ga0114129_11388726
166 Ga0157380_10025555
167 Ga0157380_10503711
168 Ga0209675_1000389
169 Ga0207653_10033747
170 Ga0207699_10000292
171 Ga0207684_10483204
172 Ga0207646_10635135
173 Ga0207681_10717587
174 Ga0207690_10342712
175 Ga0207706_10186876
176 Ga0207665_10062661
177 Ga0207675_100175784
178 Ga0209588_1003562
179 Ga0209588_1028786
180 Ga0209971_1016427
181 Ga0268265_10001128
182 Ga0265332_10009506
183 Ga0265328_10064287
184 Ga0265339_10001170
185 Ga0265313_10089742
186 Ga0265314_10000779
187 Ga0265342_10052130
188 Ga0316576_10339353
189 Ga0307415_101034909
190 Ga0373929_0000001
191 Ga0373961_0000789
192 Ga0373935_0002916
193 Ga0316582_0507129
194 Ga0436365_0939591
195 Ga0451789_1075453
196 Ga0451793_0769938
197 Ga0451577_0006987
198 Ga0453683_0024654
199 Ga0453684_0484192
200 Ga0451576_0315093
201 Ga0495638_0273658
202 Ga0495615_0002772
203 Ga0496114_0000025
204 Ga0496121_0492577
205 Ga0496122_0006225
206 Ga0496122_0129879
207 Ga0496125_0001751
208 Ga0501032_0086381
209 Ga0501036_0141126
210 Ga0501038_0154565
211 Ga0501038_0201133
212 Ga0501041_0107184
213 Ga0501042_0049496
214 Ga0501048_0009600
215 Ga0501048_0366507
216 Ga0501068_0067825
217 Ga0501068_0411644
218 Ga0501071_0024437
219 Ga0501071_0917099
220 Ga0501072_0427817
221 Ga0501073_0146042
222 Ga0501074_0896968
223 Ga0501075_0004423
224 Ga0501075_0536931
225 Ga0501076_0020094
226 Ga0501076_0022067
227 Ga0501076_1205331
228 Ga0501077_0000284
229 Ga0501079_0073129
230 Ga0501079_0533018
231 Ga0501080_0002960
232 Ga0501045_0070256
233 nmdc:mga05p37_543941_c1
234 nmdc:mga05p37_60426_c1
235 nmdc:mga05p37_830939_c1
236 nmdc:mga05p37_885322_c1
237 nmdc:mga05p37_929050_c1
238 nmdc:mga06r32_1387542_c1
239 nmdc:mga06r32_139638_c1
240 nmdc:mga08y16_570431_c1
241 nmdc:mga0n895_499748_c1
242 nmdc:mga0n895_984956_c1
243 nmdc:mga08x19_1079_c1
244 nmdc:mga0a205_277045_c1
245 Ga0501084_0306164
246 Ga0590075_107783
247 Ga0501082_0000011
248 Ga0501082_0013558
249 Ga0530510_0381569
250 Ga0530510_0708010
251 2595317635
252 2644210900
253 2819566992
254 2937845493

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

5

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9859 1 182
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9857 1 182
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9849 3 179
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9825 2 182
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9773 3 183
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.979 1 182 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9684 1 182 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9671 3 182 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9552 4 185 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9551 4 183 2.60.120.10
ID Description Score Start End GO Terms
AF-L8M5Z4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9984 4 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A323UWW4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.998 4 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1N6YHD6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.998 4 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.998 47 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A427H176-F1-model_v4 deleted 0.9978 4 182

Map