F131622

General Info

Members Datasets Scaffolds Average Seq Length
126 98 253 192

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0320880|Ga0495607_0320880_40_666
Length 208
Sequence MAESGERPREGRDMTAMAHEPHESLTQADVLLEGFLALDTPEGFRAELIEGEIVVTPPPDGDHEDYIELIVSQVYRRSQTDMQFSGNKGLKLKSGGACPKSHAIPEGTFAPRKLRLFRGAGPWMPCEGVSLVVEVTSTKPQADREAKRRCYALGGIPLYLLIDREASSVTLFRDPEGDGYRELCTLPFGKALPLPAPFAFELETAEFV

Samples

Sample ID Description Type Environment
1 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
18 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
19 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
20 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
23 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
24 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
25 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
26 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
27 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
28 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
29 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
30 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
31 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
32 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
36 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
37 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
38 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
45 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
46 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
47 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
48 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
49 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
50 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
51 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
52 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
53 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
54 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
55 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
64 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
66 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
67 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
68 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
69 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
70 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
71 2643221578 Streptomyces sp. Root63 Isolate Unclassified
72 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
73 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
74 2643221670 Streptomyces sp. Root431 Isolate Unclassified
75 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
76 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
77 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
78 2808606448 Streptomyces sp. 193411 Isolate Unclassified
79 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
80 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
81 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
82 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
83 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
84 2867428634 Streptomyces sp. RP5T Isolate Unclassified
85 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
86 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
87 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
88 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
89 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
90 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
91 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
92 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
93 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
94 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
95 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
96 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
97 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
98 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.4
Metatranscriptomes 0
Isolates 24.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 3.17
Rhizosphere 69.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495607_0320880 3300046501 Bacteria 723
2 JGI24739J22299_10039539 3300001989 Bacteria 1579
3 JGI24737J22298_10026774 3300001990 Bacteria 1820
4 JGI24735J21928_10107119 3300002067 Bacteria 803
5 rootH1_10086230 3300003316 Bacteria 3048
6 rootH1_10086230 3300003323 Bacteria 3154
7 rootH2_10021895 3300003320 Bacteria 6599
8 rootL2_10100681 3300003322 Bacteria 1251
9 rootH1_10071717 3300003323 Bacteria 5733
10 rootH1_10210621 3300003323 Bacteria 1105
11 JGI25160J50197_1021231 3300003354 Bacteria 1936
12 Ga0105239_11221779 3300010375 Bacteria 866
13 Ga0105246_10093866 3300011119 Bacteria 2169
14 Ga0157372_10101004 3300013307 Bacteria 3292
15 Ga0183367_1009 3300015688 Bacteria 484598
16 Ga0207647_10052752 3300025904 Bacteria 2509
17 Ga0207647_10086020 3300025904 Bacteria 1879
18 Ga0207702_10325425 3300026078 Bacteria 1465
19 Ga0307514_10010658 3300031649 Bacteria 7681
20 Ga0307518_10445589 3300031838 Bacteria 696
21 Ga0307416_100412470 3300032002 Bacteria 1392
22 Ga0307510_10195312 3300033180 Bacteria 1566
23 Ga0395900_0626835 3300037418 Bacteria 1014
24 Ga0395898_0014003 3300037466 Bacteria 8242
25 Ga0439436_0009135 3300041404 Bacteria 3041
26 Ga0451797_1154384 3300041453 Bacteria 926
27 Ga0451795_1368433 3300041456 Bacteria 769
28 Ga0451853_0270601 3300041512 Bacteria 3562
29 Ga0451853_0773905 3300041512 Bacteria 1414
30 Ga0439433_0029325 3300041999 Bacteria 1255
31 Ga0439449_0017528 3300042007 Bacteria 2690
32 Ga0439449_0028653 3300042007 Bacteria 2075
33 Ga0439457_002585 3300042014 Bacteria 5118
34 Ga0439462_0012139 3300042015 Bacteria 2199
35 Ga0466969_0009398 3300044656 Bacteria 5182
36 Ga0466972_0009282 3300044658 Bacteria 4942
37 Ga0466972_0026726 3300044658 Bacteria 2859
38 Ga0466972_0226325 3300044658 Bacteria 875
39 Ga0466965_0001459 3300044683 Bacteria 9555
40 Ga0466965_0122638 3300044683 Bacteria 1343
41 Ga0466965_0182983 3300044683 Bacteria 1106
42 Ga0466965_0292798 3300044683 Bacteria 882
43 Ga0466966_0044226 3300044684 Bacteria 2852
44 Ga0466966_0395696 3300044684 Bacteria 830
45 Ga0466961_0001500 3300044693 Bacteria 14483
46 Ga0466961_0042844 3300044693 Bacteria 2900
47 Ga0466963_0005265 3300044694 Bacteria 7555
48 Ga0466963_0008306 3300044694 Bacteria 6217
49 Ga0466964_0001871 3300044706 Bacteria 7340
50 Ga0466971_0001171 3300044719 Bacteria 10896
51 Ga0466971_0055880 3300044719 Bacteria 1780
52 Ga0466968_0009695 3300044735 Bacteria 3711
53 Ga0466970_0002520 3300044765 Bacteria 8835
54 Ga0466957_0033273 3300044842 Bacteria 3092
55 Ga0466959_0012836 3300045049 Bacteria 6061
56 Ga0466959_0196424 3300045049 Bacteria 1406
57 Ga0466967_0002565 3300045976 Bacteria 11399
58 Ga0466967_0055831 3300045976 Bacteria 3480
59 Ga0466967_0156228 3300045976 Bacteria 2137
60 Ga0495603_0042769 3300046455 Bacteria 2707
61 Ga0495662_0012447 3300046476 Bacteria 4153
62 Ga0495585_0089659 3300046492 Bacteria 1657
63 Ga0495611_0114731 3300046648 Bacteria 1255
64 Ga0495625_0112909 3300046660 Bacteria 1856
65 Ga0495625_0115013 3300046660 Bacteria 1836
66 Ga0495623_0075180 3300046679 Bacteria 2098
67 Ga0495670_0214164 3300046691 Bacteria 1022
68 Ga0495589_0001508 3300046794 Bacteria 13394
69 Ga0495604_0000681 3300047317 Bacteria 28787
70 Ga0495604_0004113 3300047317 Bacteria 11556
71 Ga0495676_0137784 3300047321 Bacteria 1752
72 Ga0495687_004319 3300047443 Bacteria 9674
73 Ga0495687_074918 3300047443 Bacteria 1344
74 Ga0495675_0014251 3300047444 Bacteria 5026
75 Ga0495675_0217517 3300047444 Bacteria 1157
76 Ga0495685_041317 3300047447 Bacteria 1576
77 Ga0495685_058565 3300047447 Bacteria 1300
78 Ga0496113_0805171 3300048916 Bacteria 746
79 Ga0496113_0920370 3300048916 Bacteria 691
80 Ga0501033_0317753 3300049570 Bacteria 1094
81 Ga0501033_0594448 3300049570 Bacteria 759
82 Ga0501034_0007190 3300049571 Bacteria 11881
83 Ga0501038_0071246 3300049574 Bacteria 2949
84 Ga0501043_0130678 3300049579 Bacteria 1968
85 Ga0501046_0124416 3300049580 Bacteria 1960
86 Ga0501047_0006384 3300049581 Bacteria 11088
87 Ga0501070_0430260 3300049586 Bacteria 1065
88 Ga0501070_0550051 3300049586 Bacteria 924
89 Ga0501035_0072579 3300049822 Bacteria 3046
90 Ga0501044_0000952 3300049823 Bacteria 34736
91 Ga0501044_0010102 3300049823 Bacteria 10257
92 Ga0501044_0058694 3300049823 Bacteria 3945
93 nmdc:mga0yw44_126895_c1 3300050492 Bacteria 1648
94 Ga0500560_023570 3300053107 Bacteria 1786
95 Ga0500573_0007939 3300053140 Bacteria 5824
96 Ga0466962_0020209 3300061719 Bacteria 3201
97 2616899618 2616644941 Bacteria 8510691
98 2643897551 2643221578 Bacteria 9213798
99 2644014413 2643221601 Bacteria 7493239
100 2644018055 2643221601 Bacteria 7493239
101 2644175850 2643221631 Bacteria 8168043
102 2644176658 2643221631 Bacteria 8168043
103 2644385039 2643221670 Bacteria 6497041
104 2644408696 2643221673 Bacteria 9196637
105 2785344727 2784746763 Bacteria 9783172
106 2808919412 2808606375 Bacteria 9466072
107 2809231132 2808606448 Bacteria 8656184
108 2811847794 2808606982 Bacteria 7791042
109 2812359376 2811994879 Bacteria 9313447
110 2819740539 2818991472 Bacteria 10089953
111 2852640685 2852635781 Bacteria 8251373
112 2863405979 2863404153 Bacteria 9672205
113 2867430953 2867428634 Bacteria 9590268
114 2875393501 2875391855 Bacteria 7600475
115 2877682399 2877676314 Bacteria 9512378
116 2912721307 2912715099 Bacteria 9460473
117 2946051200 2946045630 Bacteria 8527308
118 2946066517 2946064051 Bacteria 8957905
119 2954387529 2954380949 Bacteria 10050426
120 2954698374 2954691527 Bacteria 10720516
121 2990048951 2990044586 Bacteria 6603797
122 3006396096 3006393351 Bacteria 6615579
123 3006427560 3006425503 Bacteria 6491253
124 3006501326 3006493962 Bacteria 8825450
125 8008487089 8008485437 Bacteria 7198341
126 8025525150 8025524527 Bacteria 7197316
127 8056451875 8056447290 Bacteria 7680491
128 Ga0495607_0320880
129 JGI24739J22299_10039539
130 JGI24737J22298_10026774
131 JGI24735J21928_10107119
132 rootH1_10086230
133 rootH2_10021895
134 rootL2_10100681
135 rootH1_10071717
136 rootH1_10210621
137 JGI25160J50197_1021231
138 Ga0105239_11221779
139 Ga0105246_10093866
140 Ga0157372_10101004
141 Ga0183367_1009
142 Ga0207647_10052752
143 Ga0207647_10086020
144 Ga0207702_10325425
145 Ga0307514_10010658
146 Ga0307518_10445589
147 Ga0307416_100412470
148 Ga0307510_10195312
149 Ga0395900_0626835
150 Ga0395898_0014003
151 Ga0439436_0009135
152 Ga0451797_1154384
153 Ga0451795_1368433
154 Ga0451853_0270601
155 Ga0451853_0773905
156 Ga0439433_0029325
157 Ga0439449_0017528
158 Ga0439449_0028653
159 Ga0439457_002585
160 Ga0439462_0012139
161 Ga0466969_0009398
162 Ga0466972_0009282
163 Ga0466972_0026726
164 Ga0466972_0226325
165 Ga0466965_0001459
166 Ga0466965_0122638
167 Ga0466965_0182983
168 Ga0466965_0292798
169 Ga0466966_0044226
170 Ga0466966_0395696
171 Ga0466961_0001500
172 Ga0466961_0042844
173 Ga0466963_0005265
174 Ga0466963_0008306
175 Ga0466964_0001871
176 Ga0466971_0001171
177 Ga0466971_0055880
178 Ga0466968_0009695
179 Ga0466970_0002520
180 Ga0466957_0033273
181 Ga0466959_0012836
182 Ga0466959_0196424
183 Ga0466967_0002565
184 Ga0466967_0055831
185 Ga0466967_0156228
186 Ga0495603_0042769
187 Ga0495662_0012447
188 Ga0495585_0089659
189 Ga0495611_0114731
190 Ga0495625_0112909
191 Ga0495625_0115013
192 Ga0495623_0075180
193 Ga0495670_0214164
194 Ga0495589_0001508
195 Ga0495604_0000681
196 Ga0495604_0004113
197 Ga0495676_0137784
198 Ga0495687_004319
199 Ga0495687_074918
200 Ga0495675_0014251
201 Ga0495675_0217517
202 Ga0495685_041317
203 Ga0495685_058565
204 Ga0496113_0805171
205 Ga0496113_0920370
206 Ga0501033_0317753
207 Ga0501033_0594448
208 Ga0501034_0007190
209 Ga0501038_0071246
210 Ga0501043_0130678
211 Ga0501046_0124416
212 Ga0501047_0006384
213 Ga0501070_0430260
214 Ga0501070_0550051
215 Ga0501035_0072579
216 Ga0501044_0000952
217 Ga0501044_0010102
218 Ga0501044_0058694
219 nmdc:mga0yw44_126895_c1
220 Ga0500560_023570
221 Ga0500573_0007939
222 Ga0466962_0020209
223 2616899618
224 2643897551
225 2644014413
226 2644018055
227 2644175850
228 2644176658
229 2644385039
230 2644408696
231 2785344727
232 2808919412
233 2809231132
234 2811847794
235 2812359376
236 2819740539
237 2852640685
238 2863405979
239 2867430953
240 2875393501
241 2877682399
242 2912721307
243 2946051200
244 2946066517
245 2954387529
246 2954698374
247 2990048951
248 3006396096
249 3006427560
250 3006501326
251 8008487089
252 8025525150
253 8056451875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05685

Uma2

Putative restriction endonuclease

32

205

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u1r-assembly1.cif.gz_A structure analysis of a new psychrophilic marine protease 0.8389 140 167
6ixx-assembly1.cif.gz_A crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi 0.8287 140 167
1h71-assembly1.cif.gz_P psychrophilic protease from pseudoalteromonas 'tac ii 18' 0.7927 140 167
8c9k-assembly2.cif.gz_D-2 structure of mpox virus poxin 0.7413 138 169
1o0t-assembly1.cif.gz_A crystal structure of a cold adapted alkaline protease from pseudomonas tac ii 18, co-crystallized with 5 mm edta (5 days) 0.7395 140 167
ID Description Score Start End Superfamily
af_P9WKV1_107_237_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8002 139 170 3.30.420.40
af_Q9Y223_407_532_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7973 139 168 3.30.420.40
2yi1A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7823 139 168 3.30.420.40
af_Q10Q51_42_159_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7302 140 169 2.30.29.30
1wdjB00 Alpha Beta;Alpha-Beta Complex;tt1808, chain A;tt1808, chain A 0.7077 39 190 3.90.1570.10
ID Description Score Start End GO Terms
AF-A0A4R6V514-F1-model_v4 Putative restriction endonuclease 0.9808 113 189 GO:0004519
AF-A0A5C4V944-F1-model_v4 Putative restriction endonuclease domain-containing protein 0.9794 115 190
AF-A0A7W7LU35-F1-model_v4 Uma2 family endonuclease 0.9783 107 190 GO:0004519
AF-A0A7Z6T787-F1-model_v4 Uma2 domain containing protein 0.9755 39 190
AF-A0A4R4SII8-F1-model_v4 Uma2 family endonuclease 0.9741 115 177 GO:0004519

Map