F125397

General Info

Members Datasets Scaffolds Average Seq Length
125 98 125 676

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100074108|Ga0070671_1000741082
Length 741
Sequence MLSQIMRRDRGSSSGSRRLRQPFYPFSNVSGGTSSTLPTQVLKTSGFKSGKPISRQGVGYTVAMELQSPVTAVKGVGEELAKKLAVLGVKTVADLIDYLPRRYEDYSDVVAIRDTQPGPVTVKAVVKQATGRYVRRGMHITEAVASDETGSIRLIWFNQPYRANGLKVGLEYYFSGLFELSHQRMQMTSPSAELVSDFTVNTARIVPVYRETKGLTSKQIRKVVGNCRNLTRTLPXXXXKWLVQEQQLMSRSEAVLAMHFPADGAQLAEARRRLGFEEVFELSLAALMNKLELAADDSLVIPFDEQLAKDFVGHLPFKLTDAQRKAVWRIYQDMQAERPMNRLVEGDVGSGKTVVATMAALMALRQGYQAALMAPTEILARQHAETIYKLLQPLGMEAELTLLVGALTGAQKKKAQEAIAAGEARFVVGTQALIQDAVDMHKLGLVIIDEQHRFGVEQRRELMKKAGHMPHLLSLTATPIPRSLALTLYGELDISVLDQKPAGRQPIRTEIVSPNSVEPVYNDIRKDLDDGRQMFVVCPLISESGSVDAHSAEKIYEQYRKKEFKNYRLGLLHGKMKAEEKAAVMQQFVAHELDILVSTTVIEVGVDVPNASVMMIQSAERFGLAQLHQLRGRVGRGGHKAYCYLMMSDSTAPSRRLRALESSQDGFKLAELDLELRGPGAIYGQMQHGALDLRVARLTDVKLIAEARSAAAEFLERGENLVQYTELSARVTRLRTVTNLN

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
80 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
83 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
84 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
85 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
86 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
87 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
88 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
89 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
90 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
91 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
92 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
93 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
94 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
95 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
96 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
97 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
98 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.2
Nodule 0
Rhizoplane 0.8
Rhizosphere 71.2
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000026 3300001990 Bacteria 43680
2 JGI24735J21928_10000080 3300002067 Bacteria 37384
3 JGI24742J22300_10000395 3300002244 Bacteria 6490
4 rootH2_10000244 3300003320 Bacteria 697651
5 Ga0070658_10000012 3300005327 Bacteria 277871
6 Ga0070658_10002757 3300005327 Bacteria 14623
7 Ga0070676_10015889 3300005328 Bacteria 4153
8 Ga0070683_100000138 3300005329 Bacteria 47210
9 Ga0070683_100000261 3300005329 Bacteria 36323
10 Ga0070680_100024487 3300005336 Bacteria 4823
11 Ga0070682_100008335 3300005337 Bacteria 5843
12 Ga0070671_100003481 3300005355 Bacteria 12283
13 Ga0070671_100074108 3300005355 Bacteria 2844
14 Ga0070674_100005957 3300005356 Bacteria 7087
15 Ga0070673_100000224 3300005364 Bacteria 28378
16 Ga0070667_100023554 3300005367 Bacteria 5110
17 Ga0070678_100009843 3300005456 Bacteria 5812
18 Ga0070681_10010536 3300005458 Bacteria 9128
19 Ga0068867_100009996 3300005459 Bacteria 6687
20 Ga0070685_10000215 3300005466 Bacteria 38049
21 Ga0070685_10001953 3300005466 Bacteria 10699
22 Ga0070679_100001025 3300005530 Bacteria 24372
23 Ga0070679_100002235 3300005530 Bacteria 17482
24 Ga0070684_100000229 3300005535 Bacteria 38887
25 Ga0070684_100006296 3300005535 Bacteria 9170
26 Ga0068856_100004358 3300005614 Bacteria 14102
27 Ga0068856_100007844 3300005614 Bacteria 10425
28 Ga0068863_100021190 3300005841 Bacteria 6205
29 Ga0081455_10000003 3300005937 Bacteria 367763
30 Ga0075365_10000043 3300006038 Bacteria 41148
31 Ga0075365_10021744 3300006038 Bacteria 4007
32 Ga0075364_10006212 3300006051 Bacteria 7007
33 Ga0075367_10000088 3300006178 Bacteria 24938
34 Ga0075369_10000005 3300006186 Bacteria 147699
35 Ga0075366_10000294 3300006195 Bacteria 22461
36 Ga0075366_10000347 3300006195 Bacteria 21166
37 Ga0075366_10000501 3300006195 Bacteria 18164
38 Ga0068865_100061371 3300006881 Bacteria 2635
39 Ga0105240_10000003 3300009093 Bacteria 1183681
40 Ga0111539_10039892 3300009094 Bacteria 5655
41 Ga0105245_10000001 3300009098 Bacteria 939270
42 Ga0105243_10000001 3300009148 Bacteria 1156578
43 Ga0105242_10000135 3300009176 Bacteria 53544
44 Ga0105248_10073046 3300009177 Bacteria 3855
45 Ga0105237_10016883 3300009545 Bacteria 7575
46 Ga0105249_10000802 3300009553 Bacteria 28271
47 Ga0105239_10077883 3300010375 Bacteria 3648
48 Ga0157373_10000042 3300013100 Bacteria 113564
49 Ga0157374_10000195 3300013296 Bacteria 56142
50 Ga0157374_10006505 3300013296 Bacteria 9922
51 Ga0157377_10002876 3300014745 Bacteria 7692
52 Ga0157376_10000001 3300014969 Bacteria 842910
53 Ga0207645_10001659 3300025907 Bacteria 18129
54 Ga0207705_10000056 3300025909 Bacteria 157554
55 Ga0207707_10002145 3300025912 Bacteria 17855
56 Ga0207707_10049305 3300025912 Bacteria 3668
57 Ga0207695_10000005 3300025913 Bacteria 1196715
58 Ga0207652_10002984 3300025921 Bacteria 14137
59 Ga0207652_10023052 3300025921 Bacteria 5156
60 Ga0207694_10049620 3300025924 Bacteria 3249
61 Ga0207687_10000030 3300025927 Bacteria 155548
62 Ga0207687_10014067 3300025927 Bacteria 5232
63 Ga0207644_10058854 3300025931 Bacteria 2778
64 Ga0207686_10000001 3300025934 Bacteria 1169580
65 Ga0207709_10000002 3300025935 Bacteria 1171536
66 Ga0207704_10027912 3300025938 Bacteria 3123
67 Ga0207661_10000021 3300025944 Bacteria 205381
68 Ga0207661_10001940 3300025944 Bacteria 14232
69 Ga0207651_10000167 3300025960 Bacteria 28415
70 Ga0207702_10000001 3300026078 Bacteria 895738
71 Ga0207702_10006082 3300026078 Bacteria 10466
72 Ga0207702_10006432 3300026078 Bacteria 10135
73 Ga0207641_10054799 3300026088 Bacteria 3385
74 Ga0207648_10058915 3300026089 Bacteria 3349
75 Ga0207674_10075975 3300026116 Bacteria 3368
76 Ga0207683_10046114 3300026121 Bacteria 3813
77 Ga0207428_10035830 3300027907 Bacteria 4052
78 Ga0268266_10010164 3300028379 Bacteria 8246
79 Ga0265334_10000184 3300028573 Bacteria 36597
80 Ga0265338_10000192 3300028800 Bacteria 115195
81 Ga0265338_10000601 3300028800 Bacteria 63282
82 Ga0265340_10001568 3300031247 Bacteria 13122
83 Ga0265327_10000017 3300031251 Bacteria 445264
84 Ga0395900_0001560 3300037418 Bacteria 27209
85 Ga0395900_0048333 3300037418 Unclassified 4382
86 Ga0395898_0024777 3300037466 Bacteria 6049
87 Ga0395905_0000238 3300037471 Bacteria 83164
88 Ga0395905_0003963 3300037471 Bacteria 15579
89 Ga0395901_0035170 3300038443 Bacteria 5177
90 Ga0395901_0053393 3300038443 Bacteria 4199
91 Ga0495649_0000073 3300046694 Bacteria 86337
92 Ga0496112_0020640 3300048915 Bacteria 6247
93 Ga0501034_0005296 3300049571 Bacteria 14147
94 Ga0501034_0014737 3300049571 Bacteria 8047
95 Ga0501036_0062688 3300049572 Bacteria 3149
96 Ga0501047_0000229 3300049581 Bacteria 66412
97 Ga0501070_0051598 3300049586 Bacteria 3414
98 Ga0501035_0000033 3300049822 Bacteria 175087
99 nmdc:mga00v17_11970_c1 3300050491 Bacteria 4775
100 nmdc:mga0yw44_25531_c1 3300050492 Bacteria 3361
101 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
102 nmdc:mga0k408_2058_c1 3300050493 Bacteria 10755
103 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
104 nmdc:mga0k408_6766_c1 3300050493 Bacteria 6114
105 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
106 nmdc:mga08y16_56379_c1 3300050511 Bacteria 4107
107 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
108 Ga0500610_0007632 3300053079 Bacteria 4647
109 Ga0500643_000011 3300053087 Bacteria 385630
110 Ga0500644_0000626 3300053088 Bacteria 13206
111 Ga0500644_0002138 3300053088 Bacteria 5002
112 Ga0500646_0000261 3300053090 Bacteria 16106
113 Ga0500583_0000052 3300053092 Bacteria 75622
114 Ga0500651_0000240 3300053093 Bacteria 33761
115 Ga0500651_0000452 3300053093 Bacteria 21958
116 Ga0500650_0000001 3300053098 Bacteria 818797
117 Ga0500556_0000295 3300053104 Bacteria 38375
118 Ga0500562_000002 3300053108 Bacteria 977234
119 Ga0500594_0000001 3300053118 Bacteria 1178472
120 Ga0500561_0000001 3300053137 Bacteria 957685
121 Ga0500577_0001896 3300053142 Bacteria 5358
122 Ga0500579_001549 3300053143 Bacteria 13507
123 Ga0500589_000016 3300053147 Bacteria 107090
124 Ga0500633_0000659 3300053160 Bacteria 5767
125 Ga0500570_000005 3300053724 Bacteria 132994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053160 Ga0500633_0000659 Ga0500633_0000659_3939_5753 604
2 3300026116 Ga0207674_10075975 Ga0207674_100759753 654
3 3300005459 Ga0068867_100009996 Ga0068867_1000099963 663
4 3300006881 Ga0068865_100061371 Ga0068865_1000613712 663
5 3300009093 Ga0105240_10000003 Ga0105240_10000003809 663
6 3300009148 Ga0105243_10000001 Ga0105243_10000001482 663
7 3300009176 Ga0105242_10000135 Ga0105242_1000013532 663
8 3300009545 Ga0105237_10016883 Ga0105237_100168837 663
9 3300010375 Ga0105239_10077883 Ga0105239_100778831 663
10 3300025913 Ga0207695_10000005 Ga0207695_10000005819 663
11 3300025927 Ga0207687_10014067 Ga0207687_100140673 663
12 3300025934 Ga0207686_10000001 Ga0207686_10000001660 663
13 3300025935 Ga0207709_10000002 Ga0207709_10000002778 663
14 3300025938 Ga0207704_10027912 Ga0207704_100279122 663
15 3300026089 Ga0207648_10058915 Ga0207648_100589153 663
16 3300005355 Ga0070671_100003481 Ga0070671_1000034813 666
17 3300005841 Ga0068863_100021190 Ga0068863_1000211903 666
18 3300026088 Ga0207641_10054799 Ga0207641_100547992 666
19 3300005356 Ga0070674_100005957 Ga0070674_1000059574 669
20 3300005466 Ga0070685_10001953 Ga0070685_100019534 669
21 3300028379 Ga0268266_10010164 Ga0268266_1001016410 669
22 3300005329 Ga0070683_100000138 Ga0070683_10000013826 674
23 3300005535 Ga0070684_100000229 Ga0070684_10000022931 674
24 3300006051 Ga0075364_10006212 Ga0075364_100062126 674
25 3300006186 Ga0075369_10000005 Ga0075369_10000005103 674
26 3300025944 Ga0207661_10000021 Ga0207661_10000021118 674
27 3300050491 nmdc:mga00v17_11970_c1 nmdc:mga00v17_11970_c1_681_2705 674
28 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_253576_255606 674
29 3300053079 Ga0500610_0007632 Ga0500610_0007632_1625_3655 674
30 3300053088 Ga0500644_0000626 Ga0500644_0000626_7499_9523 674
31 3300053092 Ga0500583_0000052 Ga0500583_0000052_25143_27173 674
32 3300053147 Ga0500589_000016 Ga0500589_000016_82689_84719 674
33 3300005530 Ga0070679_100002235 Ga0070679_10000223511 675
34 3300006038 Ga0075365_10000043 Ga0075365_1000004325 676
35 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_257916_259946 676
36 3300005336 Ga0070680_100024487 Ga0070680_1000244875 677
37 3300005530 Ga0070679_100001025 Ga0070679_10000102510 677
38 3300005937 Ga0081455_10000003 Ga0081455_10000003320 677
39 3300049571 Ga0501034_0005296 Ga0501034_0005296_8930_10963 677
40 3300049572 Ga0501036_0062688 Ga0501036_0062688_47_2080 677
41 3300049581 Ga0501047_0000229 Ga0501047_0000229_35240_37273 677
42 3300049822 Ga0501035_0000033 Ga0501035_0000033_133284_135317 677
43 3300002244 JGI24742J22300_10000395 JGI24742J22300_100003956 678
44 3300003320 rootH2_10000244 rootH2_10000244395 678
45 3300005327 Ga0070658_10000012 Ga0070658_10000012288 678
46 3300005327 Ga0070658_10002757 Ga0070658_100027579 678
47 3300005328 Ga0070676_10015889 Ga0070676_100158893 678
48 3300005337 Ga0070682_100008335 Ga0070682_1000083356 678
49 3300005355 Ga0070671_100074108 Ga0070671_1000741082 678
50 3300005364 Ga0070673_100000224 Ga0070673_10000022416 678
51 3300005367 Ga0070667_100023554 Ga0070667_1000235544 678
52 3300005456 Ga0070678_100009843 Ga0070678_1000098433 678
53 3300005458 Ga0070681_10010536 Ga0070681_100105364 678
54 3300005466 Ga0070685_10000215 Ga0070685_100002155 678
55 3300005614 Ga0068856_100007844 Ga0068856_1000078443 678
56 3300006038 Ga0075365_10021744 Ga0075365_100217442 678
57 3300006178 Ga0075367_10000088 Ga0075367_1000008814 678
58 3300006195 Ga0075366_10000294 Ga0075366_100002945 678
59 3300006195 Ga0075366_10000347 Ga0075366_100003479 678
60 3300006195 Ga0075366_10000501 Ga0075366_1000050111 678
61 3300009094 Ga0111539_10039892 Ga0111539_100398922 678
62 3300009098 Ga0105245_10000001 Ga0105245_10000001369 678
63 3300009177 Ga0105248_10073046 Ga0105248_100730463 678
64 3300009553 Ga0105249_10000802 Ga0105249_1000080222 678
65 3300013296 Ga0157374_10000195 Ga0157374_1000019521 678
66 3300013296 Ga0157374_10006505 Ga0157374_1000650511 678
67 3300014745 Ga0157377_10002876 Ga0157377_100028767 678
68 3300014969 Ga0157376_10000001 Ga0157376_10000001132 678
69 3300025907 Ga0207645_10001659 Ga0207645_1000165910 678
70 3300025909 Ga0207705_10000056 Ga0207705_10000056136 678
71 3300025912 Ga0207707_10002145 Ga0207707_100021458 678
72 3300025912 Ga0207707_10049305 Ga0207707_100493052 678
73 3300025921 Ga0207652_10002984 Ga0207652_1000298410 678
74 3300025921 Ga0207652_10023052 Ga0207652_100230522 678
75 3300025924 Ga0207694_10049620 Ga0207694_100496202 678
76 3300025927 Ga0207687_10000030 Ga0207687_1000003070 678
77 3300025931 Ga0207644_10058854 Ga0207644_100588542 678
78 3300025960 Ga0207651_10000167 Ga0207651_1000016716 678
79 3300026078 Ga0207702_10000001 Ga0207702_10000001796 678
80 3300026078 Ga0207702_10006082 Ga0207702_100060826 678
81 3300026121 Ga0207683_10046114 Ga0207683_100461143 678
82 3300027907 Ga0207428_10035830 Ga0207428_100358305 678
83 3300028573 Ga0265334_10000184 Ga0265334_1000018422 678
84 3300028800 Ga0265338_10000192 Ga0265338_10000192107 678
85 3300028800 Ga0265338_10000601 Ga0265338_1000060154 678
86 3300031247 Ga0265340_10001568 Ga0265340_100015687 678
87 3300031251 Ga0265327_10000017 Ga0265327_10000017142 678
88 3300037418 Ga0395900_0001560 Ga0395900_0001560_10362_12398 678
89 3300037418 Ga0395900_0048333 Ga0395900_0048333_219_2255 678
90 3300037466 Ga0395898_0024777 Ga0395898_0024777_2678_4714 678
91 3300037471 Ga0395905_0000238 Ga0395905_0000238_34724_36760 678
92 3300037471 Ga0395905_0003963 Ga0395905_0003963_3549_5585 678
93 3300038443 Ga0395901_0035170 Ga0395901_0035170_600_2636 678
94 3300038443 Ga0395901_0053393 Ga0395901_0053393_1781_3844 678
95 3300046694 Ga0495649_0000073 Ga0495649_0000073_68732_70768 678
96 3300048915 Ga0496112_0020640 Ga0496112_0020640_1218_3254 678
97 3300049571 Ga0501034_0014737 Ga0501034_0014737_4592_6628 678
98 3300049586 Ga0501070_0051598 Ga0501070_0051598_1321_3357 678
99 3300050492 nmdc:mga0yw44_25531_c1 nmdc:mga0yw44_25531_c1_1195_3231 678
100 3300050493 nmdc:mga0k408_2058_c1 nmdc:mga0k408_2058_c1_4587_6623 678
101 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_10397_12433 678
102 3300050493 nmdc:mga0k408_6766_c1 nmdc:mga0k408_6766_c1_727_2763 678
103 3300050494 nmdc:mga06z11_44_c1 nmdc:mga06z11_44_c1_3912_5948 678
104 3300050511 nmdc:mga08y16_56379_c1 nmdc:mga08y16_56379_c1_1683_3719 678
105 3300053087 Ga0500643_000011 Ga0500643_000011_24259_26295 678
106 3300053088 Ga0500644_0002138 Ga0500644_0002138_637_2673 678
107 3300053090 Ga0500646_0000261 Ga0500646_0000261_2395_4431 678
108 3300053093 Ga0500651_0000240 Ga0500651_0000240_8546_10594 678
109 3300053093 Ga0500651_0000452 Ga0500651_0000452_949_2997 678
110 3300053098 Ga0500650_0000001 Ga0500650_0000001_454102_456138 678
111 3300053104 Ga0500556_0000295 Ga0500556_0000295_1912_3948 678
112 3300053108 Ga0500562_000002 Ga0500562_000002_889464_891500 678
113 3300053118 Ga0500594_0000001 Ga0500594_0000001_1115179_1117215 678
114 3300053142 Ga0500577_0001896 Ga0500577_0001896_2004_4040 678
115 3300053143 Ga0500579_001549 Ga0500579_001549_6488_8524 678
116 3300053724 Ga0500570_000005 Ga0500570_000005_37003_39039 678
117 3300005329 Ga0070683_100000261 Ga0070683_10000026117 679
118 3300005535 Ga0070684_100006296 Ga0070684_1000062967 679
119 3300005614 Ga0068856_100004358 Ga0068856_1000043586 679
120 3300013100 Ga0157373_10000042 Ga0157373_1000004255 679
121 3300025944 Ga0207661_10001940 Ga0207661_100019404 679
122 3300026078 Ga0207702_10006432 Ga0207702_100064325 679
123 3300001990 JGI24737J22298_10000026 JGI24737J22298_1000002612 680
124 3300002067 JGI24735J21928_10000080 JGI24735J21928_1000008012 680
125 3300053137 Ga0500561_0000001 Ga0500561_0000001_570294_572336 680

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17191

RecG_wedge

RecG wedge domain

69

231

0.91

PF00271

Helicase_C

Helicase conserved C-terminal domain

519

638

0.85

PF19833

RecG_dom3_C

ATP-dependent DNA helicase RecG, domain 3, C-terminal

663

741

0.84

PF00270

DEAD

DEAD/DEAH box helicase

320

487

0.81

PF04851

ResIII

Type III restriction enzyme, res subunit

316

481

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g2i-assembly1.cif.gz_B filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) at 5.9 a resolution 0.8416 61 94
6xeo-assembly1.cif.gz_A structure of mfd bound to dsdna 0.8128 205 661
6g2h-assembly1.cif.gz_E filament of acetyl-coa carboxylase and brct domains of brca1 (acc-brct) core at 4.6 a resolution 0.8038 61 94
1ue7-assembly2.cif.gz_D-3 crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis 0.801 53 131
7ssg-assembly1.cif.gz_A mfd dna complex 0.7985 234 619
ID Description Score Start End Superfamily
af_A0A0P0VNY0_1_181_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9192 288 442 3.40.50.300
af_A0A1D6HHW2_464_714_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9186 244 434 3.40.50.300
1gm5A03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9119 44 130 2.40.50.140
af_O50581_207_441_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9072 200 436 3.40.50.300
af_O50581_207_441_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8999 200 436 3.40.50.300
ID Description Score Start End GO Terms
AF-W1YQ35-F1-model_v4 Transcription-repair coupling factor 0.9563 228 332 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A536CBE8-F1-model_v4 DEAD/DEAH box helicase 0.949 235 396 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A255SW64-F1-model_v4 deleted 0.9489 290 443
AF-G9J5X6-F1-model_v4 ATP-dependent DNA helicase 0.9396 308 550 GO:0003677
GO:0003678
GO:0005524
GO:0006281
GO:0016787
AF-A0A4U9D4B1-F1-model_v4 ATP-dependent DNA helicase recG (EC 3.6.4.12) 0.9363 264 417 GO:0003677
GO:0005524
GO:0006281
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Feature Viewer

pLDDT pTM Quality
78.95 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map