F124754

General Info

Members Datasets Scaffolds Average Seq Length
125 93 125 159

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10081678|JGI25406J46586_100816781
Length 184
Sequence MSRGDLGMGGGMADDMNSMAGSGNFDAAGRMNAADTGEVCRQLNSFLRGEISAAETYKMAIDKVAKSDEPAATNANLLREIQAEHGRAAQALRDRIRELGGQASDSSGPWGAWASAVQGTANLFGDASALKSLKEGEEHGLKDYTEGIDDVDMTSADLVSNQLIPAQQRHINLLDQLINATGRA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.8
Metatranscriptomes 23.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.8
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10081678 3300003203 Bacteria 990
2 rootH2_10018424 3300003320 Bacteria 20938
3 Ga0007429J51699_1164366 3300003579 Bacteria 534
4 Ga0032354_1042614 3300003693 Bacteria 592
5 Ga0058863_11415418 3300004799 Bacteria 605
6 Ga0058860_12124141 3300004801 Unclassified 557
7 Ga0070658_10086797 3300005327 Bacteria 2574
8 Ga0070683_100320584 3300005329 Bacteria 1475
9 Ga0068869_100660670 3300005334 Unclassified 888
10 Ga0070666_10128922 3300005335 Bacteria 1757
11 Ga0070666_10189664 3300005335 Bacteria 1444
12 Ga0070687_100658663 3300005343 Unclassified 726
13 Ga0070661_100388701 3300005344 Unclassified 1101
14 Ga0070668_100694179 3300005347 Archaea 897
15 Ga0070675_100149139 3300005354 Unclassified 2004
16 Ga0070675_100226541 3300005354 Archaea 1629
17 Ga0070671_100046946 3300005355 Bacteria 3592
18 Ga0070671_101239833 3300005355 Unclassified 657
19 Ga0070673_100704827 3300005364 Bacteria 927
20 Ga0070659_101123669 3300005366 Bacteria 693
21 Ga0070667_100807081 3300005367 Unclassified 871
22 Ga0070663_100033431 3300005455 Bacteria 3553
23 Ga0070678_100038662 3300005456 Bacteria 3361
24 Ga0070678_101004260 3300005456 Unclassified 767
25 Ga0068867_100337615 3300005459 Unclassified 1253
26 Ga0070685_10053823 3300005466 Bacteria 2333
27 Ga0070684_100715066 3300005535 Bacteria 934
28 Ga0070665_100163943 3300005548 Unclassified 2225
29 Ga0070664_100198588 3300005564 Unclassified 1789
30 Ga0070664_100432025 3300005564 Bacteria 1207
31 Ga0068856_100870560 3300005614 Unclassified 920
32 Ga0068864_101043259 3300005618 Bacteria 812
33 Ga0068870_10881883 3300005840 Unclassified 631
34 Ga0068863_101343697 3300005841 Unclassified 722
35 Ga0068863_101571698 3300005841 Unclassified 667
36 Ga0068860_100300308 3300005843 Bacteria 1573
37 Ga0081539_10006134 3300005985 Bacteria 11703
38 Ga0068871_100486203 3300006358 Bacteria 1111
39 Ga0068871_100503096 3300006358 Unclassified 1092
40 Ga0075428_100767429 3300006844 Bacteria 1025
41 Ga0105239_12593705 3300010375 Unclassified 591
42 Ga0157342_1052649 3300012507 Unclassified 577
43 Ga0157371_10661998 3300013102 Bacteria 780
44 Ga0157369_10349903 3300013105 Unclassified 1535
45 Ga0157372_10397714 3300013307 Unclassified 1605
46 Ga0157372_11724178 3300013307 Bacteria 721
47 Ga0157372_12364490 3300013307 Unclassified 610
48 Ga0157375_10226169 3300013308 Bacteria 2030
49 Ga0157375_11353706 3300013308 Bacteria 838
50 Ga0163163_10300845 3300014325 Bacteria 1657
51 Ga0163163_10423874 3300014325 Bacteria 1390
52 Ga0157376_11081246 3300014969 Unclassified 827
53 Ga0163161_11091041 3300017792 Unclassified 686
54 Ga0197907_10030565 3300020069 Bacteria 617
55 Ga0197907_10083266 3300020069 Bacteria 726
56 Ga0197907_10656671 3300020069 Unclassified 613
57 Ga0206356_10456432 3300020070 Unclassified 547
58 Ga0206356_10478221 3300020070 Unclassified 571
59 Ga0206356_11002034 3300020070 Unclassified 712
60 Ga0206356_11007548 3300020070 Bacteria 603
61 Ga0206349_1206526 3300020075 Unclassified 523
62 Ga0206349_1696714 3300020075 Bacteria 538
63 Ga0206351_10714671 3300020077 Bacteria 981
64 Ga0206352_10548668 3300020078 Unclassified 579
65 Ga0206350_10500385 3300020080 Bacteria 1081
66 Ga0206350_11290241 3300020080 Bacteria 562
67 Ga0206350_11295122 3300020080 Unclassified 587
68 Ga0206354_10384382 3300020081 Bacteria 650
69 Ga0154015_1326159 3300020610 Unclassified 707
70 Ga0213876_10503124 3300021384 Bacteria 645
71 Ga0224712_10036179 3300022467 Bacteria 1827
72 Ga0224712_10199328 3300022467 Unclassified 909
73 Ga0224712_10450893 3300022467 Bacteria 618
74 Ga0224712_10538226 3300022467 Bacteria 567
75 Ga0224712_10564516 3300022467 Bacteria 554
76 Ga0207705_10078695 3300025909 Bacteria 2400
77 Ga0207649_10310424 3300025920 Unclassified 1156
78 Ga0207649_10852982 3300025920 Unclassified 713
79 Ga0207700_10488285 3300025928 Bacteria 1089
80 Ga0207664_10077659 3300025929 Bacteria 2691
81 Ga0207644_11002504 3300025931 Bacteria 701
82 Ga0207661_10151055 3300025944 Bacteria 2008
83 Ga0207679_10057982 3300025945 Unclassified 2867
84 Ga0207651_10541899 3300025960 Bacteria 1011
85 Ga0207668_10555825 3300025972 Archaea 995
86 Ga0207703_11540189 3300026035 Unclassified 640
87 Ga0207703_11663252 3300026035 Bacteria 614
88 Ga0207678_10007055 3300026067 Bacteria 9978
89 Ga0207702_11067211 3300026078 Unclassified 801
90 Ga0207648_10364235 3300026089 Bacteria 1305
91 Ga0207675_100344288 3300026118 Bacteria 1460
92 Ga0207683_10387817 3300026121 Unclassified 1284
93 Ga0207683_10842074 3300026121 Unclassified 851
94 Ga0207698_11329160 3300026142 Unclassified 734
95 Ga0307405_10034818 3300031731 Bacteria 3001
96 Ga0307410_10472303 3300031852 Bacteria 1027
97 Ga0307409_100023220 3300031995 Bacteria 4292
98 Ga0307411_10367926 3300032005 Bacteria 1178
99 Ga0373941_0426537 3300035115 Unclassified 553
100 Ga0466969_0472829 3300044656 Unclassified 571
101 Ga0466960_0879464 3300044901 Unclassified 546
102 Ga0495586_0148901 3300046535 Bacteria 1316
103 Ga0495586_0422478 3300046535 Bacteria 768
104 Ga0495656_0514799 3300046615 Bacteria 635
105 Ga0495613_0529391 3300046689 Bacteria 791
106 Ga0495680_0538076 3300047322 Bacteria 789
107 Ga0495675_0594369 3300047444 Unclassified 628
108 Ga0495684_0401097 3300047471 Bacteria 963
109 Ga0496110_0563632 3300048913 Bacteria 1035
110 Ga0501306_075304 3300049127 Unclassified 575
111 Ga0501309_070358 3300049129 Unclassified 574
112 Ga0501309_078490 3300049129 Unclassified 551
113 Ga0501307_086164 3300049162 Bacteria 519
114 Ga0501034_0000813 3300049571 Bacteria 46435
115 Ga0501034_0023884 3300049571 Bacteria 6223
116 Ga0501047_0104089 3300049581 Unclassified 2719
117 Ga0501070_0114672 3300049586 Unclassified 2226
118 Ga0501080_0202619 3300049742 Unclassified 1821
119 Ga0501080_0620927 3300049742 Bacteria 958
120 Ga0501083_0001638 3300049744 Bacteria 15309
121 Ga0501044_0002791 3300049823 Bacteria 19896
122 Ga0501044_0014701 3300049823 Bacteria 8439
123 Ga0501044_0194808 3300049823 Bacteria 1987
124 Ga0501084_0891173 3300054114 Bacteria 748
125 Ga0501082_0087886 3300060353 Bacteria 2682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11353706 Ga0157375_113537062 139
2 3300020075 Ga0206349_1206526 Ga0206349_12065261 142
3 3300020077 Ga0206351_10714671 Ga0206351_107146711 142
4 3300020080 Ga0206350_10500385 Ga0206350_105003852 142
5 3300020610 Ga0154015_1326159 Ga0154015_13261592 142
6 3300022467 Ga0224712_10036179 Ga0224712_100361793 142
7 3300003320 rootH2_10018424 rootH2_100184242 143
8 3300044656 Ga0466969_0472829 Ga0466969_0472829_36_473 143
9 3300020075 Ga0206349_1696714 Ga0206349_16967141 144
10 3300021384 Ga0213876_10503124 Ga0213876_105031241 144
11 3300022467 Ga0224712_10538226 Ga0224712_105382261 144
12 3300005334 Ga0068869_100660670 Ga0068869_1006606702 145
13 3300005343 Ga0070687_100658663 Ga0070687_1006586631 145
14 3300005455 Ga0070663_100033431 Ga0070663_1000334313 145
15 3300005456 Ga0070678_100038662 Ga0070678_1000386621 145
16 3300005459 Ga0068867_100337615 Ga0068867_1003376151 145
17 3300005466 Ga0070685_10053823 Ga0070685_100538231 145
18 3300005840 Ga0068870_10881883 Ga0068870_108818831 145
19 3300014325 Ga0163163_10423874 Ga0163163_104238742 145
20 3300025920 Ga0207649_10852982 Ga0207649_108529821 145
21 3300026035 Ga0207703_11540189 Ga0207703_115401891 145
22 3300026067 Ga0207678_10007055 Ga0207678_100070553 145
23 3300026089 Ga0207648_10364235 Ga0207648_103642352 145
24 3300026118 Ga0207675_100344288 Ga0207675_1003442882 145
25 3300026121 Ga0207683_10387817 Ga0207683_103878171 145
26 3300035115 Ga0373941_0426537 Ga0373941_0426537_54_491 145
27 3300003579 Ga0007429J51699_1164366 Ga0007429J51699_11643661 147
28 3300025928 Ga0207700_10488285 Ga0207700_104882851 149
29 3300005327 Ga0070658_10086797 Ga0070658_100867972 150
30 3300025909 Ga0207705_10078695 Ga0207705_100786951 150
31 3300054114 Ga0501084_0891173 Ga0501084_0891173_187_648 151
32 3300017792 Ga0163161_11091041 Ga0163161_110910411 153
33 3300020070 Ga0206356_11002034 Ga0206356_110020342 153
34 3300022467 Ga0224712_10199328 Ga0224712_101993281 153
35 3300044901 Ga0466960_0879464 Ga0466960_0879464_55_519 153
36 3300046615 Ga0495656_0514799 Ga0495656_0514799_137_625 153
37 3300013102 Ga0157371_10661998 Ga0157371_106619981 154
38 3300020069 Ga0197907_10083266 Ga0197907_100832661 154
39 3300020070 Ga0206356_10478221 Ga0206356_104782211 154
40 3300026121 Ga0207683_10842074 Ga0207683_108420741 154
41 3300049162 Ga0501307_086164 Ga0501307_086164_12_491 154
42 3300004799 Ga0058863_11415418 Ga0058863_114154181 155
43 3300005456 Ga0070678_101004260 Ga0070678_1010042601 155
44 3300006844 Ga0075428_100767429 Ga0075428_1007674291 155
45 3300020069 Ga0197907_10030565 Ga0197907_100305651 155
46 3300020070 Ga0206356_11007548 Ga0206356_110075481 155
47 3300020080 Ga0206350_11290241 Ga0206350_112902411 155
48 3300022467 Ga0224712_10450893 Ga0224712_104508931 155
49 3300031731 Ga0307405_10034818 Ga0307405_100348181 155
50 3300031852 Ga0307410_10472303 Ga0307410_104723031 155
51 3300031995 Ga0307409_100023220 Ga0307409_1000232204 155
52 3300032005 Ga0307411_10367926 Ga0307411_103679261 155
53 3300005347 Ga0070668_100694179 Ga0070668_1006941791 156
54 3300005354 Ga0070675_100226541 Ga0070675_1002265411 156
55 3300020081 Ga0206354_10384382 Ga0206354_103843821 156
56 3300025972 Ga0207668_10555825 Ga0207668_105558251 156
57 3300026035 Ga0207703_11663252 Ga0207703_116632521 156
58 3300047322 Ga0495680_0538076 Ga0495680_0538076_231_728 156
59 3300047471 Ga0495684_0401097 Ga0495684_0401097_376_873 156
60 3300005344 Ga0070661_100388701 Ga0070661_1003887012 157
61 3300005354 Ga0070675_100149139 Ga0070675_1001491392 157
62 3300005355 Ga0070671_100046946 Ga0070671_1000469463 157
63 3300005564 Ga0070664_100198588 Ga0070664_1001985882 157
64 3300013105 Ga0157369_10349903 Ga0157369_103499032 157
65 3300013307 Ga0157372_11724178 Ga0157372_117241781 157
66 3300014325 Ga0163163_10300845 Ga0163163_103008453 157
67 3300025920 Ga0207649_10310424 Ga0207649_103104241 157
68 3300025929 Ga0207664_10077659 Ga0207664_100776592 157
69 3300025945 Ga0207679_10057982 Ga0207679_100579823 157
70 3300048913 Ga0496110_0563632 Ga0496110_0563632_509_1003 157
71 3300003693 Ga0032354_1042614 Ga0032354_10426141 158
72 3300005841 Ga0068863_101343697 Ga0068863_1013436971 158
73 3300049127 Ga0501306_075304 Ga0501306_075304_89_565 158
74 3300005548 Ga0070665_100163943 Ga0070665_1001639433 159
75 3300005614 Ga0068856_100870560 Ga0068856_1008705601 159
76 3300005618 Ga0068864_101043259 Ga0068864_1010432591 159
77 3300010375 Ga0105239_12593705 Ga0105239_125937051 159
78 3300026078 Ga0207702_11067211 Ga0207702_110672111 159
79 3300013307 Ga0157372_10397714 Ga0157372_103977142 160
80 3300020078 Ga0206352_10548668 Ga0206352_105486681 160
81 3300020080 Ga0206350_11295122 Ga0206350_112951221 160
82 3300004801 Ga0058860_12124141 Ga0058860_121241411 161
83 3300006358 Ga0068871_100503096 Ga0068871_1005030962 161
84 3300014969 Ga0157376_11081246 Ga0157376_110812461 161
85 3300046535 Ga0495586_0422478 Ga0495586_0422478_66_578 161
86 3300025931 Ga0207644_11002504 Ga0207644_110025041 162
87 3300005355 Ga0070671_101239833 Ga0070671_1012398331 163
88 3300005366 Ga0070659_101123669 Ga0070659_1011236691 165
89 3300046689 Ga0495613_0529391 Ga0495613_0529391_208_705 165
90 3300049129 Ga0501309_070358 Ga0501309_070358_13_519 165
91 3300049129 Ga0501309_078490 Ga0501309_078490_41_541 165
92 3300005329 Ga0070683_100320584 Ga0070683_1003205842 166
93 3300005535 Ga0070684_100715066 Ga0070684_1007150661 166
94 3300005564 Ga0070664_100432025 Ga0070664_1004320252 166
95 3300025944 Ga0207661_10151055 Ga0207661_101510552 166
96 3300012507 Ga0157342_1052649 Ga0157342_10526491 167
97 3300026142 Ga0207698_11329160 Ga0207698_113291601 167
98 3300013307 Ga0157372_12364490 Ga0157372_123644901 168
99 3300020070 Ga0206356_10456432 Ga0206356_104564321 168
100 3300047444 Ga0495675_0594369 Ga0495675_0594369_97_606 168
101 3300005335 Ga0070666_10128922 Ga0070666_101289221 169
102 3300005335 Ga0070666_10189664 Ga0070666_101896642 169
103 3300005364 Ga0070673_100704827 Ga0070673_1007048272 169
104 3300005367 Ga0070667_100807081 Ga0070667_1008070812 169
105 3300005843 Ga0068860_100300308 Ga0068860_1003003081 169
106 3300006358 Ga0068871_100486203 Ga0068871_1004862032 169
107 3300013308 Ga0157375_10226169 Ga0157375_102261693 169
108 3300022467 Ga0224712_10564516 Ga0224712_105645161 169
109 3300025960 Ga0207651_10541899 Ga0207651_105418992 169
110 3300049571 Ga0501034_0023884 Ga0501034_0023884_4106_4618 169
111 3300049581 Ga0501047_0104089 Ga0501047_0104089_606_1118 169
112 3300049586 Ga0501070_0114672 Ga0501070_0114672_340_852 169
113 3300049823 Ga0501044_0002791 Ga0501044_0002791_16874_17386 169
114 3300049823 Ga0501044_0194808 Ga0501044_0194808_962_1474 169
115 3300060353 Ga0501082_0087886 Ga0501082_0087886_861_1373 169
116 3300005841 Ga0068863_101571698 Ga0068863_1015716981 170
117 3300049571 Ga0501034_0000813 Ga0501034_0000813_13645_14157 170
118 3300049742 Ga0501080_0202619 Ga0501080_0202619_102_617 170
119 3300049742 Ga0501080_0620927 Ga0501080_0620927_18_530 170
120 3300049744 Ga0501083_0001638 Ga0501083_0001638_13406_14092 170
121 3300049823 Ga0501044_0014701 Ga0501044_0014701_4527_5039 170
122 3300046535 Ga0495586_0148901 Ga0495586_0148901_714_1241 172
123 3300020069 Ga0197907_10656671 Ga0197907_106566711 178
124 3300003203 JGI25406J46586_10081678 JGI25406J46586_100816781 184
125 3300005985 Ga0081539_10006134 Ga0081539_100061347 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09537

DUF2383

Domain of unknown function (DUF2383)

38

150

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.8723 36 184
5d8s-assembly1.cif.gz_A-2 2.55a resolution structure of bfrb (e85a) from pseudomonas aeruginosa 0.8612 39 183
2qqy-assembly1.cif.gz_A crystal structure of ferritin like, diiron-carboxylate proteins from bacillus anthracis str. ames 0.8592 35 178
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.8591 36 184
1nf6-assembly2.cif.gz_F "x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states (""cycled"" structure: reduced in solution and allowed to reoxidise before crystallisation)" 0.8589 32 183
ID Description Score Start End Superfamily
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8723 36 184 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8591 36 184 1.20.1260.10
1nf6F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8589 32 183 1.20.1260.10
3fvbA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8511 37 182 1.20.1260.10
af_Q54XF9_6_149_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8508 34 179 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A848WPG5-F1-model_v4 DUF2383 domain-containing protein 0.9587 37 181
AF-A0A858RNC0-F1-model_v4 DUF2383 domain-containing protein 0.9543 35 179
AF-A0A177MLT2-F1-model_v4 DUF2383 domain-containing protein 0.9502 40 181
AF-L7U590-F1-model_v4 DUF2383 domain-containing protein 0.9486 34 181
AF-A0A2V7Z5S4-F1-model_v4 Ferritin 0.9449 33 184

Feature Viewer

pLDDT pTM Quality
81.87 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map